Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G04020-AT4G22240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):fibrillin
Function (paralog2):Plastid-lipid associated protein PAP / fibrillin family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.80769386320235
Log2 mRNA fold difference:-0.3427894773486
Log2 TE fold difference:-0.63696868070088
Sequences
Protein sequence

MATVPLFTQFPCKTLNPSSSNTKHQSKSPILLPINSINRRSEIGVSVHRPDFKIRATDID
DEWGQDGVERVFASSSTVSVADKAIESVEETERLKRSLADSLYGTDRGLSVSSDTRAEIS
ELITQLESKNPTPAPNEALFLLNGKWILAYTSFVGLFPLLSRRIEPLVKVDEISQTIDSD
SFTVQNSVRFAGPFSTTSFSTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSIEIPESVEVL
GQKIDLNPIKGLLTSVQDTASSVARTISNQPPLKFSLPSDNTQSWLLTTYLDKDLRISRG
DGGSVYVLIKEGSSLLNP

MATVQLSTQFSCQTRVSISPNSKSISKPPFLVPVTSIIHRPMISTGGIAVSPRRVFKVRA
TDTGEIGSALLAAEEAIEDVEETERLKRSLVDSLYGTDRGLSASSETRAEIGDLITQLES
KNPTPAPTEALFLLNGKWILAYTSFVNLFPLLSRGIVPLIKVDEISQTIDSDNFTVQNSV
RFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSIEIPEYVEVLGQKIDLNP
IRGLLTSVQDTASSVARTISSQPPLKFSLPADNAQSWLLTTYLDKDIRISRGDGGSVFVL
IKEGSPLLNP

Other information
Ka divergence:0.130768KaKs divergence:-0.577419
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):957Length 2 (bp):933Length divergence:-0.013
MFE 1 (kcal):-287.82MFE 2 (kcal):-281.22MFE divergence-0.012