Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G04210-AT4G22150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plant UBX domain containing protein 4
Function (paralog2):plant UBX domain-containing protein 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.8840088414718
Log2 mRNA fold difference:-0.90655726662659
Log2 TE fold difference:-0.92322934622631
Sequences
Protein sequence

MSSKDKKPSKPSSSRGGIRTLSDLNRRSGPDSDSDSDGPQEYYTGGEKSGMLVQDPSKKD
DVDEIFNQARQLGAVEGPLEPPPSSRSFTGTGRLLSGENVPTGNQQPEPVVHNIVFWSNG
FTIDDGPLRKLDDPENASFLESIRKSECPKELEPADRRAPVHVNLMRKEEKCPERQKRRV
SFQGVGRTLGGSNEGSGSSSPVAPDSAPIPIQTEPAPSQSLVIDETVPTTSIQLRLADGT
RLVAKFNHHHTVNDIRGFIDSSRPGASLNYQLQTMGFPPKPLTDLTQTIEEAGLANSVVL
QKF

MLVLFLAKHTRIREHALELTRSVLHALGFRVKALFSVLLFHKFDFLIPNPFPFYSDQSSE
KSIGDMSSKDKKLSKPTSGRTGGIRTLSDLNRRSEPDSDSDSDGPQEYFTGGEKSGMLVQ
DPTKEPKHDDVDEIFNQARQLGAVEGPLEHPSSSRSFTGTGRLLSGESVPTALQQPEPVI
HNIIFWSNGFTVDDGPLRKLDDPENASFLDSIRKSECPKELEPVDKRAPVHVNLMRRDEK
CPEKEKLKVSFQGVGRTLGGASSSTASSQSNLTDVAAVQSPLQSLVVDETLPSTSIQLRL
ADGTRMVAKFNNHHTVNDIRGFIEFSRPGNPNNYTLQVMGFPPKPLTDPSQTIEQAGLAS
SVVIQKF

Other information
Ka divergence:0.0740741KaKs divergence:0.0295666
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):912Length 2 (bp):1104Length divergence:0.095
MFE 1 (kcal):-289.04MFE 2 (kcal):-308.71MFE divergence0.033