Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G04340-AT4G22120
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ERD (early-responsive to dehydration stress) family protein
Function (paralog2):ERD (early-responsive to dehydration stress) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.8903352763614
Log2 mRNA fold difference:-2.4462811155344
Log2 TE fold difference:-0.36416182542977
Sequences
Protein sequence

MATLKDIGVSAGINILTAFIFFIIFAFLRLQPFNDRVYFSKWYLRGLRSSPASGGGFAGR
FVNLELRSYLKFLHWMPEALKMPERELIDHAGLDSVVYLRIYWLGLKIFAPIAMLAWAVL
VPVNWTNNELELAKHFKNVTSSDIDKLTISNIPEGSNRFWAHIIMAYAFTIWTCYMLMKE
YETVANMRLQFLASEGRRPDQFTVLVRNVPPDPDETVSELVEHFFLVNHPDNYLTHQVVC
NANKLADLVSKKTKLQNWLDYYQLKYTRNNSQIRPITKLGCLGLCGQKVDAIEHYIAEVD
KTSKEIAEERENVVNDQKSVMPASFVSFKTRWAAAVCAQTTQTRNPTEWLTEWAAEPRDI
YWPNLAIPYVSLTVRRLVMNVAFFFLTFFFIIPIAFVQSLATIEGIEKVAPFLKVIIEKD
FIKSLIQGLLAGIALKLFLIFLPAILMTMSKFEGFTSVSFLERRSASRYYIFNLVNVFLG
SVIAGAAFEQLNSFLNQSPNQIPKTIGMAIPMKATFFITYIMVDGWAGVAGEILMLKPLI
IYHLKNAFLVKTEKDREEAMNPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFA
LAYVVYRHQIINVYNQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAASAAPFLI
ALPVITIGFHRFCKGRFEPAFVRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKG
GDNDDDGDMIGKLENEVIIVPTKRQSRRNTPAPSRISGESSPSLAVINGKEV

MATLQDIGVSAGINILSAFVFFIIFAVLRLQPFNDRVYFSKWYLKGLRSSPARGGAFAQR
FVNLDFRSYMKFLNWMPEALKMPEPELIDHAGLDSVVYLRIYWLGLKIFTPIAVLAWAVL
VPVNWTNNTLEMAKQLRNVTSSDIDKLSVSNIPEYSMRFWTHIVMAYAFTIWTCYVLMKE
YETIANMRLQFVASEARRPDQFTVLVRNVPPDADESVSELVEHFFLVNHPDHYLTHQVVC
NANKLADLVKKKKKLQNWLDYYQLKYARNNSQRIMVKLGFLGLWGQKVDAIEHYIAEIDK
ISKEISKEREEVVNDPKAIMPAAFVSFKTRWAAAVCAQTQQTRNPTQWLTEWAPEPRDVF
WSNLAIPYVSLTVRRLIMHVAFFFLTFFFIVPIAFVQSLATIEGIVKAAPFLKFIVDDKF
MKSVIQGFLPGIALKLFLAFLPSILMIMSKFEGFTSISSLERRAAFRYYIFNLVNVFLAS
VIAGAAFEQLNSFLNQSANQIPKTIGVAIPMKATFFITYIMVDGWAGVAGEILMLKPLIM
FHLKNAFLVKTDKDREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFAL
AYIVYRHQIINVYNQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIA
LPVLTIGFHHFCKGRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGD
EDDYDIDDKLGKFEDEAIIVPTKRQSRRNTPAPSIISGDDSPSLPFSGKLV

Other information
Ka divergence:-0.105862KaKs divergence:0.227754
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2319Length 2 (bp):2316Length divergence:-0.001
MFE 1 (kcal):-682.23MFE 2 (kcal):-688.63MFE divergence0.005