Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G04610-AT4G21990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):APS reductase 1
Function (paralog2):APS reductase 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.3334727435802
Log2 mRNA fold difference:-1.0555494762136
Log2 TE fold difference:-0.15292414069273
Sequences
Protein sequence

MAMSVNVSSSSSSGIINSRFGVSLEPKVSQIGSLRLLDRVHVAPVSLNLSGKRSSSVKPL
NAEPKTKDSMIPLAATMVAEIAEEVEVVEIEDFEELAKKLENASPLEIMDKALEKYGNDI
AIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDAVEKHYGIRIEYMFPDSV
EVQGLVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLKAWITGQRKDQSPGTRSEIPVV
QVDPVFEGLDGGVGSLVKWNPVANVEGNDVWNFLRTMDVPVNTLHAAGYISIGCEPCTKA
VLPGQHEREGRWWWEDAKAKECGLHKGNVKENSDDAKVNGESKSAVADIFKSENLVTLSR
QGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASYDELADKLAGSGIKVAKFRADGDQKE
FAKQELQLGSFPTILVFPKNSSRPIKYPSEKRDVESLTSFLNLVR

MALAINVSSSSSSAISSSSFPSSDLKVTKIGSLRLLNRTNVSAASLSLSGKRSSVKALNV
QSITKESIVASEVTEKLDVVEVEDFEELAKRLENASPLEIMDKALEKFGNDIAIAFSGAE
DVALIEYAHLTGRPYRVFSLDTGRLNPETYRLFDTVEKHYGIRIEYMFPDAVEVQALVRN
KGLFSFYEDGHQECCRIRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEG
LDGGVGSLVKWNPVANVEGNDVWNFLRTMDVPVNTLHAAGYVSIGCEPCTRAVLPGQHER
EGRWWWEDAKAKECGLHKGNIKENTNGNATANVNGTASVADIFNSENVVNLSRQGIENLM
KLENRKEAWIVVLYAPWCPFCQAMEASFDELADKLGGSGVKVAKFRADGDQKDFAKKELQ
LGSFPTILVFPKNSSRPIKYPSEKRDVDSLTSFLNLVR

Other information
Ka divergence:0.0601852KaKs divergence:0.491239
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1398Length 2 (bp):1377Length divergence:-0.008
MFE 1 (kcal):-440.34MFE 2 (kcal):-421.53MFE divergence-0.022