Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G04860-AT4G21810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DERLIN-2.2
Function (paralog2):DERLIN-2.1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.83514320825318
Log2 mRNA fold difference:0.93040508470313
Log2 TE fold difference:-0.24560464354941
Sequences
Protein sequence

MAQAVEEWYKQMPIITRSYLTAAVITTVGCSLDIISPYNLYLNPTLVVKQYQYWRLVTNF
LYFRKMDLDFMFHMFFLARYCKLLEENSFRGKTADFLYMLLFGASVLTGIVLIGGMIPYL
SASFAKIIFLSNSLTFMMVYVWSKQNPYIHMSFLGLFTFTAAYLPWVLLGFSILVGASAW
VDLLGMIAGHAYYFLAEVYPRMTNRRPLKTPSFLKALFADEPVVVARPEDVRFAAAPFDE
IHQD

MAQAVEEWYKQMPIITRSYLTAAVVTTVGCSLEIISPYNLYLNPTLVVKQYQFWRLVTNF
LYFRKMDLDFLFHMFFLARYCKLLEENSFRGKTADFLYMLLFGATVLTGIVLIGGMIPYL
SVSFSKIIFLSNSLTFMMVYVWSKQNPYIHMSFLGLFTFTAAYLPWVLLGFSILVGASAW
GDFLGMIAGHAYYFLAFVYPRMTDRRPLKTPSFLKALFADEPVVIARPEDVRFAHAPFDE
IHQD

Other information
Ka divergence:0.420048KaKs divergence:0.238985
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):735Length 2 (bp):735Length divergence:0
MFE 1 (kcal):-208.91MFE 2 (kcal):-212.16MFE divergence0.008