Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G05000-AT4G21560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Vacuolar protein sorting-associated protein VPS28 family protein
Function (paralog2):vacuolar protein sorting-associated protein 28 homolog 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.16424795895993
Log2 mRNA fold difference:-0.044335776297313
Log2 TE fold difference:0.25828403172452
Sequences
Protein sequence

MMEVKLWNDKREREMYENFAELFAIIKATEKLEKAYIRDLINPSEYESECQKLIVHFKTL
SATLKDTVPNIERFADTYKMDCPAALYRLVTSGLPATVEHRATVAASTSNSASIVAECVQ
NFITSMDSLKLNMVAVDQVYPLLSDLSASLNKLSILPPDFEGKTKMKEWLSRLSKMGAAD
ELTEQQSRQLHFDLESSYNSFMAALPKAGN

MEVKLWNDKREREMYENFAELYAIIKATEKLEKAYIRDLISPSEYETECQKLIVHFKTLS
ASLKDMVPNIERFAETYKMDCSAAVYRLVTSGVPATVEHRAAASASTSSSASVVAECVQN
FITSMDSLKLNMVAVDQVYPLLSDLSASLNKLSILPPDFEGKIKMKEWLLRLSKMGASDE
LTEQQARQLHFDLESSYNSFMAALPNAGN

www.000webhost.com

Other information
Ka divergence:0.141335KaKs divergence:0.582535
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):633Length 2 (bp):630Length divergence:-0.002
MFE 1 (kcal):-157.51MFE 2 (kcal):-195.55MFE divergence0.108