Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G05010-AT4G21510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):F-box family protein
Function (paralog2):F-box family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2753568298267
Log2 mRNA fold difference:-1.5867904935485
Log2 TE fold difference:0.34983514373173
Sequences
Protein sequence

MAYLSDGFEMKSTREYERLGLGFVRFTRGLGRKRILISKRAPENDSPPVKRPSHETTESC
RSLLETLHQDILIRVLCHVDHEDLATLKRVSKTIRKAVIEAKKSHFDYSTPKKRLPFRDA
ILILDSNSNSSSQDDEMEPPNAPIRRRFINRESDLSKISMVLFK

MIHYLHFIGEFCFSSAVKVVEWFSENLFLKRSTMALSKRGFVMTSNARFHGEEEELELGL
GSVRFTRGLGRKRILISSCVRESLSRSAVEIPVVSESPPVKSSLKRQRSRITIVSSSSSE
KSRLECLPQDLLIRVICGVDHEDLKSLKLVSKSIREASLVAKTLHFAYTTPKKTRAFRNS
IDLEEVSDSRHQEDDIEPPNAPRHYRWTKAKRKEQLSSVSAALFT

Other information
Ka divergence:-0.501387KaKs divergence:0.999473
GC content 1 (%):39GC content 2 (%):43GC content divergence:0.049
Length 1 (bp):495Length 2 (bp):678Length divergence:0.156
MFE 1 (kcal):-121.06MFE 2 (kcal):-202.71MFE divergence0.252