Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G05060-AT4G21450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PapD-like superfamily protein
Function (paralog2):PapD-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.95626591304157
Log2 mRNA fold difference:1.5813215115886
Log2 TE fold difference:-0.5499194775012
Sequences
Protein sequence

MALTEDKSDSDGRRWGKFKLPFRNSNSQAPSASSSSSMATSSSSVTSSHLNQNYIHQSRH
FQYHGPPVVEGLGQNHHQSAATIPSMSSVARSLLPTKRRLKLDPSAKLYFPYEPGKQVRS
AIKIKNTSKSHVAFKFQTTVPKSCFMRPAGAILAPGEEIIATVFKFVEPPENNEKPMEQK
SGVKFKIMSLKMKVPTDYMPELFEEQKDHVSEEQVMRVVFLDPENPNSMMEKLKSQLAEA
DAADEARKKASEGIVGPKPIGEGLVIDEWKQRRERYLAQQQGGVDAA

MTMTEEKPTSDGKGGWGFFKIPFRNSSGHRNAASSAATSPFPSGASSSSTSSHLHNHHQH
HHQHHHQHHHQLGYNGPHGDGSGQNQHPTPSPSVSSVAKSFLPTKRRLKLDPSEKLYFPW
FVSEDLRSIDTSLKFLSFNEPGKQVRSAIKIKNTSKSHVAFKFQTTAPKSCFMRPPGAIL
APGETIIATVFKFVEPPENNEKPMDQRSRVKFKIMSLKVKGPMDYVPELFDEQKDDVSKE
QILRVIFLDPERSNPALEKLKRQLAEADAAVEARKKPPEETGPKMIGEGLVIDEWKERRE
RYLAQQQGEGADSV

www.000webhost.com

Other information
Ka divergence:-0.426952KaKs divergence:-0.32631
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):864Length 2 (bp):945Length divergence:0.045
MFE 1 (kcal):-233.81MFE 2 (kcal):-288.31MFE divergence0.104