Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G05100-AT4G21440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 74
Function (paralog2):MYB-like 102

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.069747689306523
Log2 mRNA fold difference:-0.60649414815093
Log2 TE fold difference:0.40465064547664
Sequences
Protein sequence

MGRSPCCEKKNGLKKGPWTPEEDQKLIDYINIHGYGNWRTLPKNAGLQRCGKSCRLRWTN
YLRPDIKRGRFSFEEEETIIQLHSIMGNKWSAIAARLPGRTDNEIKNYWNTHIRKRLLKM
GIDPVTHTPRLDLLDISSILSSSIYNSSHHHHHHHQQHMNMSRLMMSDGNHQPLVNPEIL
KLATSLFSNQNHPNNTHENNTVNQTEVNQYQTGYNMPGNEELQSWFPIMDQFTNFQDLMP
MKTTVQNSLSYDDDCSKSNFVLEPYYSDFASVLTTPSSSPTPLNSSSSTYINSSTCSTED
EKESYYSDNITNYSFDVNGFLQFQ

MARSPCCEKNGLKKGPWTSEEDQKLVDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNY
LRPDIKRGRFSFEEEETIIQLHSFLGNKWSAIAARLPGRTDNEIKNFWNTHIRKKLLRMG
IDPVTHSPRLDLLDISSILASSLYNSSSHHMNMSRLMMDTNRRHHQQHPLVNPEILKLAT
SLFSQNQNQNLVVDHDSRTQEKQTVYSQTGVNQYQTNQYFENTITQELQSSMPPFPNEAR
QFNNMDHHFNGFGEQNLVSTSTTSVQDCYNPSFNDYSSSNFVLDPSYSDQSFNFANSVLN
TPSSSPSPTTLNSSYINSSSCSTEDEIESYCSNLMKFDIPDFLDVNGFII

www.000webhost.com

Other information
Ka divergence:-0.0415765KaKs divergence:-0.263697
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):975Length 2 (bp):1053Length divergence:0.038
MFE 1 (kcal):-233.01MFE 2 (kcal):-249.57MFE divergence0.034