Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G05180-AT4G21280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):photosystem II subunit Q-2
Function (paralog2):photosystem II subunit QA

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.53710865960078
Log2 mRNA fold difference:-1.0624425728702
Log2 TE fold difference:0.68088790535298
Sequences
Protein sequence

MAQAVTSMAGLRGASQAVLEGSLQINGSNRLNISRVSVGSQRTGLVIRAQQNVSVPESSR
RSVIGLVAAGLAGGSFVKAVFAEAIPIKVGGPPLPSGGLPGTDNSDQARDFSLALKDRFY
IQPLSPTEAAARAKDSAKEIINVKSFIDKKAWPYVQNDLRLRASYLRYDLNTVISAKPKE
EKQSLKDLTAKLFQTIDNLDYAARSKSSPDAEKYYSETVSSLNNVLAKLG

MASMGGLHGASPAVLEGSLKINGSSRLNGSGRVAVAQRSRLVVRAQQSEETSRRSVIGLV
AAGLAGGSFVQAVLADAISIKVGPPPAPSGGLPAGTDNSDQARDFALALKDRFYLQPLPP
TEAAARAKESAKDIINVKPLIDRKAWPYVQNDLRSKASYLRYDLNTIISSKPKDEKKSLK
DLTTKLFDTIDNLDYAAKKKSPSQAEKYYAETVSALNEVLAKLG

www.000webhost.com

Other information
Ka divergence:0.0977289KaKs divergence:0.364042
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):693Length 2 (bp):675Length divergence:-0.013
MFE 1 (kcal):-207.9MFE 2 (kcal):-223.39MFE divergence0.036