Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G05190-AT4G21270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):kinesin 5
Function (paralog2):kinesin 1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.93669899328665
Log2 mRNA fold difference:-1.3320507826141
Log2 TE fold difference:0.3933722009347
Sequences
Protein sequence

MPLRNQNRAPLPSPNVKKEALSSIPFDKRRKETQGTGRRQVLSTVNRQDANSDVGSTEEC
GKVEFTKDEVLALLNERAKAGKFDTKGKIEQMTDIIKKLKVCVRWYQQVDETHVQDKENL
SSSLQSAEKRYSDKELDAKTKEEELRATITEMKENIESLQEKLSKEKLSKLDAIENHRRE
KDCRVVAEKLQVSLREELDKVKEEKMAAKQKVTSLEDMYKRLQEYNTSLQQYNTKLQTDL
EVAREAHTRAEKEKSSILENLTTLRGHSKSLQDQLASSRVSQDEAVKQKDSLLMEVNNLQ
SELQQVRDDRDRHVVQSQKLAGEILMYKESVGKSSHELDILIAKSGSLEETCSLQKERIK
MLEQELAFAKEKLKMVDLSMSHTMTEFEEQKQCMHELQDRLADTERQLFEGELLRKKLHN
TILELKGNIRVFCRVRPLLPDDGGRQEASVIAYPTSTESLGRGIDVVQSGNKHPFTFDKV
FDHGASQEEVFFEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGRPETPEQKGLIPRSL
EQIFKTSQSLSTQGWKYKMQVSMLEIYNESIRDLLSTSRTIAIESVRADSSTSGRQYTIT
HDVNGNTHVSDLTIVDVCSIGQISSLLQQAAQSRSVGKTHMNEQSSRSHFVFTLRISGVN
ESTEQQVQGVLNLIDLAGSERLSRSGATGDRLKETQAINKSLSALSDVIFALAKKEDHVP
FRNSKLTYLLQPCLGGDSKTLMFVNISPDPSSTGESLCSLRFAARVNACEIGIPRRQTSA
KLLDSRLSYG

MASRNQNRPPRSPNAKKEGLGGISFDKRRKVETQGGTGRRQAFSAVNKQDVTMNSDVGSI
EECGKVDFTKDEILALLSERAKAGKFDTKAKIEQMTDIIKRLKVCVKWFQQADETHVQEK
ENLKVSLESSEQKYNHKELEARTKEEELQATISKLEENVVSLHEKLAKEESSTQDAIECH
RREKEARVAAEKVQASLGEELDKVKEEKMAAKQKVTSLEDMYKRLQEYNTSLQQYNSKLQ
TDLETVRAALTRAEKEKSSILENLSTLRGHSKSLQDQLSSSRVLQDDAIKQKDSLLSEVT
NLRNELQQVRDDRDRQVVQSQKLSEEIRKYQENVGKSSQELDILTAKSGSLEETCSLQKE
RLNMLEQQLAIANERQKMADASVSLTRTEFEEQKHLLCELQDRLADMEHQLCEGELLRKK
LHNTILELKGNIRVFCRVRPLLPDDGGRHEATVIAYPTSTEAQGRGVDLVQSGNKHPFTF
DKVFNHEASQEEVFFEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGRPEAPDQKGLIP
RSLEQIFQASQSLGAQGWKYKMQVSMLEIYNETIRDLLSTNRTTSMDLVRADSGTSGKQY
TITHDVNGHTHVSDLTIFDVCSVGKISSLLQQAAQSRSVGKTQMNEQSSRSHFVFTMRIS
GVNESTEQQVQGVLNLIDLAGSERLSKSGATGDRLKETQAINKSLSALSDVIFALAKKED
HVPFRNSKLTYLLQPCLGGDSKTLMFVNISPDPTSAGESLCSLRFAARVNACEIGIPRRQ
TSTKLLDSRLSYG

www.000webhost.com

Other information
Ka divergence:-0.114107KaKs divergence:0.104195
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):2373Length 2 (bp):2382Length divergence:0.002
MFE 1 (kcal):-678.23MFE 2 (kcal):-701.65MFE divergence0.017