Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G05330-AT4G21160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ARF-GAP domain 13
Function (paralog2):Calcium-dependent ARF-type GTPase activating protein family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.4436451819717
Log2 mRNA fold difference:1.2487011435154
Log2 TE fold difference:0.9041953249343
Sequences
Protein sequence

MSNYAAGLGKPGSGKRRIRDLLNQPDNRVCADCGASDPKWASANIGVFICLKCCGVHRSL
GTHISKVLSVTLDEWSDEEVDSMIEIGGNASANSIYEAFLPDTCSKPGPDVNHDQRMRFI
RAKYELQEFLKPSLRITSGKGSTKSSAFLTSSLSRKIMDSFRTNSSSQTMFQEGMVEFIG
LLKVTIKKGTNLAIRDMMSSDPYVVLNLGKQKLQTTVMNSNLNPVWNQELMLSVPESYGP
VKLQVYDYDTFSADDIMGEADIDIQPLITSAMAFGDPEMFGDMQIGKWLKSHDNPLIDDS
IINIVDGKVKQEVQIKLQNVESGELELEMEWLPLDQ

MSYSGAGLGKPGSGKRRIRDLLTQSDNRVCADCGAPDPKWASANIGVFICLKCCGVHRSL
GSHISKVLSVTLDEWSDEEVDSMIEIGGNASANSIYEAFIPEGSSKPGPDASHDQRMRFI
RSKYEHQEFLKPSLRITSVRGSSTKTPAFLSSSLSKKIVDSFRTNSSSQQPQLEGMVEFI
GLLKVTIKKGTNMAIRDMMSSDPYVVLTLGQQKAQSTVVKSNLNPVWNEELMLSVPHNYG
SVKLQVFDYDTFSADDIMGEAEIDIQPLITSAMAFGDPEMFGDMQIGKWLKSHDNALIED
SIINIADGKVKQEVQIKLQNVESGELELEMEWLPLEQ

www.000webhost.com

Other information
Ka divergence:-0.0874023KaKs divergence:0.328458
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):1011Length 2 (bp):1014Length divergence:0.001
MFE 1 (kcal):-297.8MFE 2 (kcal):-310.19MFE divergence0.02