Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G05400-AT4G21140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):copper ion binding
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2310418011792
Log2 mRNA fold difference:-0.61844894966631
Log2 TE fold difference:-0.56270680535716
Sequences
Protein sequence

MIRVTKPKAIIESLSYHLIQRCSASGTPKGKAKLKTGQPLKRNKLSIKKGGGGGGAPVEG
EEAVKGKGRISDEKQKLYEQCLNAPCPVRYLTPQEIEREAQREKLGLISKEKQRDMEIQK
KGGAASMGVTDEPMRIGTPGLDYISLGIFEAEELPKYKLTEEDGERLAKEYSKVLMREHR
ERRAAETALLNLKKSAIEALPENLKKAALEPDLTPFPANRGMATLTPPIEGYLEKVMDAA
KKSSSKEKLR

MIRFARPKPIIDSVSYNLLQKCYASGTPKGKSKLKTGQSLKRNKLTIKKGGGNGGGRGGD
EVDKGKGRISDQCINAPCPVRYLRPKEREREARREKLGLISKARQKEIDFQKKGGSFTMG
VTTAPMRIGTPGLDYISLGIFTEDELPKYKVTVEDGIRLAKEYSRVLMREHRARRVAEIS
LMKMRNAAVEALPENLKKAALVRDLTPFPVSRGTATLTPPIEGYLERIMNAAARKSSGKE
KLR

www.000webhost.com

Other information
Ka divergence:0.373384KaKs divergence:0.719261
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):753Length 2 (bp):732Length divergence:-0.014
MFE 1 (kcal):-216.9MFE 2 (kcal):-200.14MFE divergence-0.04