Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G05420-AT4G21100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):damaged DNA binding protein 1A
Function (paralog2):damaged DNA binding protein 1B

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0173613668088
Log2 mRNA fold difference:-1.5440750501639
Log2 TE fold difference:0.6273063035116
Sequences
Protein sequence

MSSWNYVVTAHKPTSVTHSCVGNFTSPQELNLIVAKCTRIEIHLLTPQGLQPMLDVPIYG
RIATLELFRPHGEAQDFLFIATERYKFCVLQWDPESSELITRAMGDVSDRIGRPTDNGQI
GIIDPDCRLIGLHLYDGLFKVIPFDNKGQLKEAFNIRLEELQVLDIKFLFGCAKPTIAVL
YQDNKDARHVKTYEVSLKDKDFVEGPWSQNSLDNGADLLIPVPPPLCGVLIIGEETIVYC
SASAFKAIPIRPSITKAYGRVDVDGSRYLLGDHAGMIHLLVITHEKEKVTGLKIELLGET
SIASTISYLDNAVVFVGSSYGDSQLVKLNLHPDAKGSYVEVLERYINLGPIVDFCVVDLE
RQGQGQVVTCSGAFKDGSLRVVRNGIGINEQASVELQGIKGMWSLKSSIDEAFDTFLVVS
FISETRILAMNLEDELEETEIEGFLSQVQTLFCHDAVYNQLVQVTSNSVRLVSSTTRELR
DEWHAPAGFTVNVATANASQVLLATGGGHLVYLEIGDGKLTEVQHALLEYEVSCLDINPI
GDNPNYSQLAAVGMWTDISVRIFSLPELTLITKEQLGGEIIPRSVLLCAFEGISYLLCAL
GDGHLLNFQMDTTTGQLKDRKKVSLGTQPITLRTFSSKSATHVFAASDRPTVIYSSNKKL
LYSNVNLKEVSHMCPFNSAAFPDSLAIAREGELTIGTIDDIQKLHIRTIPLGEHARRICH
QEQTRTFGICSLGNQSNSEESEMHFVRLLDDQTFEFMSTYPLDSFEYGCSILSCSFTEDK
NVYYCVGTAYVLPEENEPTKGRILVFIVEDGRLQLIAEKETKGAVYSLNAFNGKLLAAIN
QKIQLYKWMLRDDGTRELQSECGHHGHILALYVQTRGDFIVVGDLMKSISLLLYKHEEGA
IEERARDYNANWMSAVEILDDDIYLGAENNFNLLTVKKNSEGATDEERGRLEVVGEYHLG
EFVNRFRHGSLVMRLPDSEIGQIPTVIFGTVNGVIGVIASLPQEQYTFLEKLQSSLRKVI
KGVGGLSHEQWRSFNNEKRTAEARNFLDGDLIESFLDLSRNKMEDISKSMNVQVEELCKR
VEELTRLH

MSVWNYAVTAQKPTCVTHSCVGNFTSPQELNLIVAKSTRIEIHLLSPQGLQTILDVPLYG
RIATMELFRPHGEAQDFLFVATERYKFCVLQWDYESSELITRAMGDVSDRIGRPTDNGQI
GIIDPDCRVIGLHLYDGLFKVIPFDNKGQLKEAFNIRLEELQVLDIKFLYGCTKPTIAVL
YQDNKDARHVKTYEVSLKDKNFVEGPWSQNNLDNGADLLIPVPSPLCGVLIIGEETIVYC
SANAFKAIPIRPSITKAYGRVDLDGSRYLLGDHAGLIHLLVITHEKEKVTGLKIELLGET
SIASSISYLDNAVVFVGSSYGDSQLIKLNLQPDAKGSYVEILEKYVNLGPIVDFCVVDLE
RQGQGQVVTCSGAYKDGSLRIVRNGIGINEQASVELQGIKGMWSLKSSIDEAFDTFLVVS
FISETRILAMNIEDELEETEIEGFLSEVQTLFCHDAVYNQLVQVTSNSVRLVSSTTRELR
NKWDAPAGFSVNVATANASQVLLATGGGHLVYLEIGDGTLTEVKHVLLEYEVSCLDINPI
GDNPNYSQLAAVGMWTDISVRIFVLPDLTLITKEELGGEIIPRSVLLCAFEGISYLLCAL
GDGHLLNFQLDTSCGKLRDRKKVSLGTRPITLRTFSSKSATHVFAASDRPAVIYSNNKKL
LYSNVNLKEVSHMCPFNSAAFPDSLAIAREGELTIGTIDDIQKLHIRTIPIGEHARRICH
QEQTRTFAISCLRNEPSAEESESHFVRLLDAQSFEFLSSYPLDAFECGCSILSCSFTDDK
NVYYCVGTAYVLPEENEPTKGRILVFIVEEGRLQLITEKETKGAVYSLNAFNGKLLASIN
QKIQLYKWMLRDDGTRELQSECGHHGHILALYVQTRGDFIAVGDLMKSISLLIYKHEEGA
IEERARDYNANWMTAVEILNDDIYLGTDNCFNIFTVKKNNEGATDEERARMEVVGEYHIG
EFVNRFRHGSLVMKLPDSDIGQIPTVIFGTVSGMIGVIASLPQEQYAFLEKLQTSLRKVI
KGVGGLSHEQWRSFNNEKRTAEAKGYLDGDLIESFLDLSRGKMEEISKGMDVQVEELCKR
VEELTRLH

www.000webhost.com

Other information
Ka divergence:0.461723KaKs divergence:0.591767
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):3267Length 2 (bp):3267Length divergence:0
MFE 1 (kcal):-986.05MFE 2 (kcal):-1010.03MFE divergence0.012