Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G05450-AT4G21090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):mitochondrial ferredoxin 1
Function (paralog2):MITOCHONDRIAL FERREDOXIN 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.29360212346369
Log2 mRNA fold difference:1.6567195709176
Log2 TE fold difference:-1.3690815584719
Sequences
Protein sequence

MIGHRISRLGSTIVKQLAREGYLATYGTKNLHRSYGHYLQSLPVVPRQARTSQEAWFLKS
HKFCTSSTTSSENGDEETEKITIIFVDKDGEEIPVKVPIGMSVLEAAHENDIDLEGACEA
SLACSTCHVIVMDTEYYNKLEEPTDEENDMLDLAFGLTETSRLGCQVIARPELDGVRLAI
PSATRNFAVDGFVPKPH

MVFHRLSRLGSRIVKELPRERHLSMCGKRILQRSYGQYLQSSPMLQRQTRSFKEALFSNN
HKFCTSFSTTSEKGGEKTEKINVTFVDKDGEEIHIKVPVGMNILEAAHENDIELEGACEG
SLACSTCHVIVMDTKYYNKLEEPTDEENDMLDLAFGLTATSRLGCQVIAKPELDGVRLAI
PSATRNFAVDGFVPKPH

Other information
Ka divergence:-0.351683KaKs divergence:-0.453215
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):594Length 2 (bp):594Length divergence:0
MFE 1 (kcal):-169.5MFE 2 (kcal):-154.51MFE divergence-0.046