Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G08870-AT4G08900
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Arginase/deacetylase superfamily protein
Function (paralog2):arginase

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.9912295208633
Log2 mRNA fold difference:-3.176469067219
Log2 TE fold difference:-0.87500406999578
Sequences
Protein sequence

MWKIGQRGVPYFQRLIAAPFTTLRSLPTSLVETGQNRVIDASLTLIRERAKLKGELVRLI
GGAKATTALLGVPLGHNSSFLEGPALAPPHVREAIWCGSTNSTTEEGKELKDPRVLSDVG
DIPVQEIREMGVDDDRLMKVVSESVKLVMEEEPLRPLVIGGDHSISYPVVRAVSEKLGGP
VDILHLDAHPDIYDRFEGNYYSHASSFARIMEGGYARRLLQVGIRSINKEGREQGKRFGV
EQYEMRTFSKDRQMLENLKLGEGVKGVYISIDVDCLDPGFAHGVSHFEPGGLSFRDVLNI
LHNLQGDLVGADVVEYNPQRDTADDMTAMVAAKFVRELAAKMSK

MSRIIGRKGINYIHRLNSASFTSVSASSIEKGQNRVIDASLTLIRERAKLKGELVRLLGG
AKASTSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSATEEGKELKDPRVLTDVGDV
PVQEIRDCGVDDDRLMNVISESVKLVMEEEPLRPLVLGGDHSISYPVVRAVSEKLGGPVD
ILHLDAHPDIYDCFEGNKYSHASSFARIMEGGYARRLLQVGIRSINQEGREQGKRFGVEQ
YEMRTFSKDRPMLENLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILH
NLQADVVGADVVEFNPQRDTVDGMTAMVAAKLVRELAAKISK

www.000webhost.com

Other information
Ka divergence:-0.422524KaKs divergence:-0.662788
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):1035Length 2 (bp):1029Length divergence:-0.003
MFE 1 (kcal):-335.78MFE 2 (kcal):-324.07MFE divergence-0.018