Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G10280-AT4G10290
Species:Arabidopsis
Duplication type:TD
Function (paralog1):RmlC-like cupins superfamily protein
Function (paralog2):RmlC-like cupins superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.10184836196972
Log2 mRNA fold difference:-0.0077567262806022
Log2 TE fold difference:0.06264473479114
Sequences
Protein sequence

MGNHFLTLSLLLVTVCVCVSFITTKLNPKEAIVSVSSDSEIPTEIHGVKILRQASDTKLA
QLGVASWPKWEGAPSKFPWEFKKTETIYFMEGKVKVNVDGYDEEEETFEIGKGDVVVFPK
DMKVVWEITEAVKKQYSLEE

MELNHDSIFAPEVPTEIHGVKVMRQTSDAKLAELGVTSWQLWESMPRKFPWKFKKTETMY
FVEGKLKVKVEDHHKEGEALEFVAGDLVVFPQDMNVFVDVIEDVKKRYYRESEIEESELP

www.000webhost.com

Other information
Ka divergence:0.474468KaKs divergence:0.634843
GC content 1 (%):41GC content 2 (%):39GC content divergence:-0.025
Length 1 (bp):423Length 2 (bp):363Length divergence:-0.076
MFE 1 (kcal):-120.52MFE 2 (kcal):-91.8MFE divergence-0.135