Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G10570-AT4G10590
Species:Arabidopsis
Duplication type:TD
Function (paralog1):ubiquitin-specific protease 9
Function (paralog2):ubiquitin-specific protease 10

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.24970047280712
Log2 mRNA fold difference:0.15987783871191
Log2 TE fold difference:0.12848095564009
Sequences
Protein sequence

MTIPNSDFMLENGVCDLPFTPEEEKRIVSELTSESEDNLKQGNLYFVISKRWYTSWQEYV
ENSANECSTGESSEAPRPGPIDNHDIIESDSDINDPQLRRLLVEGEDYVLVPKQVWKRLV
EWYSGGPPIERKLICQGFYTRSYSVEVYPLCLMLTDGRDESRTVIRLGKQASIRELYEKV
CAMTGVPQEKAHIWDYFDKRKNGLLDPLSYKSLEESSLHMDQDILVEVDGLSSSSQSAMS
STGNELALVPLEPSRSIVTIAGGPTLSNGHSTTSNFSLFPRITSEDDGRDSLSILGKGEK
GGLAGLSNLGNTCFMNSALQCLAHTPPIVEYFLQDYSDDINRDNPLGMCGELAIAFGDLL
KKLWSSGRNAVAPRAFKTKLARFAPQFSGYNQHDSQELLAFLLDGLHEDLNKVKRKPYIE
LKDSDSRPDDEVAEELWNYHKARNDSVIVDVCQGQYKSTLVCPVCGKISITFDPFMYLSV
PLPSTLTRSMTITVFYCDGSRLPMPYTVIVPKQGSIRDLITALGTACCLAEDESLLLAEV
YDHKIFRYFEIPLDSLSAIKDDEHIVAYRLNQIPKGSRKAKLEILHGGQERAVLDSVRGS
DVKLFGTPFVTYVNTEPLSGTDIDAVISGFLSPLHKVHAPSKIHNGSDNGHLADATVDQA
SGILSSPDTEIDNASDRELSFRIFLTDERGLNIKPLQSESSISPGTVTRVLVEWNEGEHE
RYDSSYLSDLPEVHKTSFSAKKTRQESISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQA
NKKLDLWKLPDILVFHLKRFTYSRYLKNKIDTFVNFPVHDLDLSKYVKNKNGQSYLYELY
AVSNHYGGLGGGHYTAYAKLIDDNKWYHFDDSHVSSVNESEIRNSAAYVLFYRRVRSETE
TQTAEMSTDMDYSCLNSHNDKAS

MTIPNSDFMIENGVCDFPTTPEEEKRIVSELITESEDNLKEGNLYFVISKRWYTSWEKYV
EQSTKEYISGESSEASRPGPIDNHDIIESESDVNDPQLRRLLMERVDYVLVPQEVWKRLV
EWYSGGPPIERKLICQGFYTRSYSVEVYPLCLMLTDGRDESRTVIRLGKQASIRELYEKV
CALTGVPQEKAHIWDYFDKRKNGLLDSLSYKSLEESSLHMDQDILLEVDGSSSSQSAMSS
TGNELALVPLEPSRSSVTIAGGPTLSNGHSTTSNFSLFPRITSEDDGSNSLSILGKGEKG
GLAGLSNLGNTCFMNSALQCLAHTPPIVEYFLQDYSDDINRDNPLGMCGELAIAFGDLLK
KLWSSGRNSVAPRAFKTKLARFAPQFSGYNQHDSQELLAFLLDGLHEDLNKVKRKPYIEL
KDSDSRPDDEVAEELWNYHKARNDSVIVDVCQGQYKSTLVCPACGKISITFDPFMYLSVP
LPSTLTRSMTVTVFYCDGSHLPMPYTVIVPKNGSIRDLITALGTACLLAEDESLLLAEVY
DHKIFKYFENPLDSLSSIKDDEHIVAYRLNQMPKGSGKAKLEILHGGQKRPILESVRGRD
VKLFGTPFVTYVNTEPLSGADIDAVLSRFLSPLHKVHAPSKIHNGSENGHLPDATVDEAS
EILSSPDTEIDDASDRELSFRIFLTDERGLNFKPLQSESSISLGIATRVLVEWNEGEHER
YDSSYLSDLPEVHKTSFSAKKTRQESISLFSCLEAFLAEEPLGPDDMWFCPSCKEHRQAN
KKLDLWKLPDILVFHLKRFTYSRYLKNKIDTFVNFPVHDLDLSKYVKNKNDQSYLYELYA
VSNHYGGLGGGHYTAYAKLIDDNEWYHFDDSHVSSVNESEIKNSAAYVLFYRRVRSETET
QTVEMSTDMD

Other information
Ka divergence:0.00390698KaKs divergence:-0.10328
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):2772Length 2 (bp):2733Length divergence:-0.007
MFE 1 (kcal):-839.56MFE 2 (kcal):-808.62MFE divergence-0.019