Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G10670-AT4G10710
Species:Arabidopsis
Duplication type:TD
Function (paralog1):GTC2
Function (paralog2):global transcription factor C

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:4.0821525745631
Log2 mRNA fold difference:5.0740038261467
Log2 TE fold difference:-1.1957558689268
Sequences
Protein sequence

MITVDHKSDTVLLPIYGRMVPFNVTTIRTVLGNQNTIRVIFNVPGTPLNPNDSLKNKDAI
YLKEVSFRTKDSRHSSDVVQQVKSLRRKVMARESERAERTSLVNQEKLQIVRNNSKPLSL
SNLWIRPPFSGRKKNRGTLEAHVNGFRYSTTNERVDVLFANIKHAFFQPAEKEMTTLLHF
HLHNHIMVGTKKTKDVQFYVEVMDVVQSLGGRRRSSAYDADEIVEEQRERDRKNKINMDF
NHFANQVNDMWQLPQFASLSLEFDQPLREFGFNGVPHKTSTFIIPTSSCLVELTESPFLV
VCLSEIEIVNLERVGFGQKSFDMAIIFKDLKKDVLRVDSVPTS

MADSRNGNARAPPSGVPPKAGNTYSIDVKNFISRARALYEHWKKHSADLWGSADALAIAT
PPASDDLRYLKSSALNIWLLGYEFPDTIMVFTKKQIHFLCSRNKASLLEVVKKPAHDELK
LDVIMHVKPKGDDGTGLMDAIFRAIRDLSRGDGNDSQVVGHIAREAPEGKLLETWTERLK
NANFQFVDITGGLSDLFAVKDDTEVMSVKKAAYLAYSVMKNVVVPNLESAIDEEKDVTHS
ALMDLTEKAILEPTKASVKLKPENVDICYPPIFQSGGKFDLKPSAASNDELLTYDPASII
ICAVGARYNSYCSNVARTYLIDATSLQSKAYEVLLKAHEAAIDALRSGRKINTVYQAALS
VVEKNAPEFVDKLTKSAGTGIGLEFRESGLNINAKNDKVLRPKMAFNVSLGFQNLECESE
SRSKNKKFSLLLADTVLVTDQKPELLTKCSKSVKDVAYSFKEDEEEEKPRKKARTSGSEN
YITKTALRSDDHVVSKEELRKQHQAELARQKNEETARRLAGDSSGAGDSRSTAKTSADVV
AYKNVNDMPHKELMIQVDTRNEAVLLPIYGSLVPFHVATIRTVSGNQDTNRNCYIRIIFN
VPGTPFNPHDSNSLKNQGAIYLKEVSFRTKDSRHSSEVTQQIKTLRRQVMARESERAERA
TLVTQEKLQLAGNKFKPLRLSELWIRPPFSGRKKIPGTLEAHANGFRYSTTRPDERVDVL
FANIKHAFFQPAEKEMITLLHFHLHNHIMVGTKKTKDVQFYVEVMDVVQSLGGGRRSAYD
PDEIDEEQRERDRKNKINMDFNHFANRVNDMWQLPQFASLDLEFDQPLRELGFHGVPHKT
SAFIIPTSSCLVELIEYPFLVVSLSEIEIVNLERVGFGQKNFDMAIIFKDFKKDVLRVDS
VPTSSLEGIKEWLDTTDIKYYESKLNLNWRQILKTITDDPQSFIDDGGWEFLNLDGSDSE
SGGSEESDKGYEPSDVEVESESEDEASESESLVESDDDEEEDSEQESEEEKGKTWDELER
EATNADREHGVESDSEEERKRRKMKAFGKSRPGTSGGGGSSSMKNMPPSKRKHR

www.000webhost.com

Other information
Ka divergence:-0.788051KaKs divergence:0.99882
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1032Length 2 (bp):3225Length divergence:0.515
MFE 1 (kcal):-293.87MFE 2 (kcal):-1000.81MFE divergence0.546