Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G10730-AT4G24100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.922178464499
Log2 mRNA fold difference:0.13260770934092
Log2 TE fold difference:2.3528819377323
Sequences
Protein sequence

MVSRFRLALEAVLGSRRRKKMASTSSGGGGGGDKKKKKGFSVNPKDYKLMEEVGYGASAV
VHRAIYLPTNEVVAIKSLDLDRCNSNLDDIRREAQTMTLIDHPNVIKSFCSFAVDHHLWV
VMPFMAQGSCLHLMKAAYPDGFEEAAICSMLKETLKALDYLHRQGHIHRDVKAGNILLDD
TGEIKLGDFGVSACLFDNGDRQRARNTFVGTPCWMAPEVLQPGSGYNSKADIWSFGITAL
ELAHGHAPFSKYPPMKVLLMTIQNAPPGLDYDRDKKFSKSFKELVALCLVKDQTKRPTAE
KLLKHSFFKNVKPPEICVKKLFVDLPPLWTRVKALQAKDAAQLALKGMASADQDAISQSE
YQRGVSAWNFNIEDLKEQASLLDDDDILTESREEEESFGEQLHNKVNDRGQVSGSQLLSE
NMNGKEKASDTEVVEPICEEKSTLNSTTSSVEQPASSSEQDVPQAKGKPVRLQTHSGPLS
SGVVLINSDSEKVHGYERSESERQLKSSVRRAPSFSGPLNLPNRASANSLSAPIKSSGGF
RDSIDDKSKANVVQIKGRFSVTSENLDLARASPLRKSASVGNWILDSKMPTGQAIKESSS
HLSFIIPQLQNLFQQNSMQQDLIMNLVNTLQQAAETTDGSQNGKLPPLPRGSDSNGTVVE
LTAAERERLLLTKITELRARMKELTEELEVEKSKQTQLQQKLKSVTGREQL

MVGGGGGSSGRGGGSGSGSSKQQRGFSMNPKDYKLMEEIGHGASAVVYRAIYLPTNEVVA
IKCLDLDRCNSNLDDIRRESQTMSLIDHPNVIKSFCSFSVDHSLWVVMPFMAQGSCLHLM
KTAYSDGFEESAICCVLKETLKALDYLHRQGHIHRDVKAGNILLDDNGEIKLGDFGVSAC
LFDNGDRQRARNTFVGTPCWMAPEVLQPGNGYNSKADIWSFGITALELAHGHAPFSKYPP
MKVLLMTIQNAPPGLDYDRDKKFSKSFKEMVAMCLVKDQTKRPTAEKLLKHSCFKHTKPP
EQTVKILFSDLPPLWTRVKSLQDKDAQQLALKRMATADEEAISQSEYQRGVSAWNFDVRD
LKTQASLLIDDDDLEESKEDEEILCAQFNKVNDREQVFDSLQLYENMNGKEKVSNTEVEE
PTCKEKFTFVTTTSSLERMSPNSEHDIPEAKVKPLRRQSQSGPLTSRTVLSHSASEKSHI
FERSESEPQTAPTVRRAPSFSGPLNLSTRASSNSLSAPIKYSGGFRDSLDDKSKANLVQK
GRFSVTSGNVDLAKDVPLSIVPRRSPQATPLRKSASVGNWILEPKMPTAQPQTIKEHSSH
PTSSSPIMPQLQHLFQQNSIQQDLIMNLLNSLQPVEATEGSQSGKLPPLPRSDSNGNVEP
VASERERLLLSSISDLRARLDDLTEELDIEKSKYSQLQQKLKAFTGREH

Other information
Ka divergence:-0.0268174KaKs divergence:0.0946356
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2136Length 2 (bp):2130Length divergence:-0.001
MFE 1 (kcal):-612.84MFE 2 (kcal):-611.13MFE divergence-0.001