Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G10970-AT4G23910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.18808377250448
Log2 mRNA fold difference:0.050811488819021
Log2 TE fold difference:0.35249407643409
Sequences
Protein sequence

MDMSLDEIIKMEKSNTNVNKGKKQRVLNKKEKFSGAAKNSAVKAQRYMDSRSDVRQGAFA
KKRSNFQGNQFPVTTTVARKAASATPRGRPYNGGRMTNTNQSSWSIVGRLKWVDARLLRQ
HEDSDAQIFMIEHATDHSSSCLLLIPDKVLKNYRETGVSVLVFFHSILHEPATYFLCTEG
IRIMKFIAPPAQNRASQRGFVGKQQQQQREKIVQQQANGGGGGQRQWPQTLDSRFANMKE
ERMRMRRFADNRSNVGNNGAGSHQQQRSMVPWVRRATRFPN

METGTPLIAETIALTEKKVAMALDDIIKLAKRKTNVNKGKKPRREKNKNQNFNGAARNNT
SNVRHHMNSLSAVRQGAVGKRRSRFQGIQFPVTTNIARKASTAAPLDFRGRAFNGGRMTS
ANQSRLIAPPVQNISVQARVNAKRHEVDQKVEHRGGKRKTLDSRFASMKEQRMTINNYGV
TVQVPRLPPWVRARRFSQ

www.000webhost.com

Other information
Ka divergence:0.310433KaKs divergence:-0.585418
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):846Length 2 (bp):597Length divergence:-0.173
MFE 1 (kcal):-243.06MFE 2 (kcal):-143.34MFE divergence-0.258