Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G11010-AT4G23900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nucleoside diphosphate kinase 3
Function (paralog2):Nucleoside diphosphate kinase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-4.0148563855559
Log2 mRNA fold difference:-3.6849603774969
Log2 TE fold difference:-0.34355912012801
Sequences
Protein sequence

MSSQICRSASKAAKSLLSSAKNARFFSEGRAIGAAAAVSASGKIPLYASNFARSSGSGVA
SKSWITGLLALPAAAYMIQDQEVLAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLV
GIKVIVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWEGDGVIRYGRKLIGATDP
QKSEPGTIRGDLAVTVGRNIIHGSDGPETAKDEISLWFKPQELVSYTSNSEKWLYGDN

MSSQICRSASRAARSLLSSAKNARFFSEGRAIGAASVVHATGKVPQYASNFGKSGSGFVS
NSWITGLLALPAAAFMLQDQEALAAEMERTFIAIKPDGVQRGLISEIITRFERKGYKLVG
IKVMVPSKGFAQKHYHDLKERPFFNGLCNFLSSGPVVAMVWEGEGVIRYGRKLIGATDPQ
KSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEISLWFKPEELVSYTSNAEKWIYGQN

Other information
Ka divergence:0.150224KaKs divergence:0.377778
GC content 1 (%):44GC content 2 (%):48GC content divergence:0.043
Length 1 (bp):717Length 2 (bp):714Length divergence:-0.002
MFE 1 (kcal):-224.83MFE 2 (kcal):-236.22MFE divergence0.025