Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G11080-AT4G23800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):HMG (high mobility group) box protein
Function (paralog2):HMG (high mobility group) box protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.0038034153381
Log2 mRNA fold difference:1.8077240721268
Log2 TE fold difference:1.1002826751979
Sequences
Protein sequence

MSTVSSDPAHAKKSRNSRKALKQKNEIVESSPVSDKGKETKSFEKDLMEMQAMLEKMKIE
KEKTEDLLKEKDEILRKKEVEQEKLKTELKKLQKMKEFKPNMTFAFSQSLAQTEEEKKGK
KKKKDCAETKRPSTPYILWCKDNWNEVKKQNPEADFKETSNILGAKWKGISAEEKKPYEE
KYQADKEAYLQVITKEKREREAMKLLDDEQKQKTAMELLDQYLHFVQEAEHDNKKKAKKI
KDPLKPKQPISAYLIYANERRAALKGENKSVIEVAKMAGEEWKNLSEEKKAPYDQMAKKN
KEIYLQEMEGYKRTKEEEAMSQKKEEEEFMKLHKQEALQLLKKKEKTDNIIKKTKETAKN
KKKNENVDPNKPKKPTSSYFLFCKDARKSVLEEHPGINNSTVTAHISLKWMELGEEEKQV
YNSKAAELMEAYKKEVEEYNKTKTSS

MATNADPAPTKKPRNSRKALKQKNELVETPPSPVSVKGKSAKSFEQDLMEMQTMLEKMKI
EKDKTEELLKEKDEILRKKEEELETRDAEQEKLKVELKKLQKMKEFKPNMTFACGQSSLT
QAEQEKANKKKKKDCPETKRPSSSYVLWCKDQWTEVKKENPEADFKETSNILGAKWKSLS
AEDKKPYEERYQVEKEAYLQVIAKEKREKEAMKLLEDDQKQRTAMELLDQYLNFVQEAEQ
DNKKKNKKEKDPLKPKHPVSAFLVYANERRAALREENKSVVEVAKITGEEWKNLSDKKKA
PYEKVAKKNKETYLQAMEEYKRTKEEEALSQKKEEEELLKLHKQEALQMLKKKEKTDNLI
KKEKATKKKKNENVDPNKPKKPASSYFLFSKDERKKLTEERPGTNNATVTALISLKWKEL
SEEEKQVYNGKAAKLMEAYKKEVEAYNKKSAATTSS

www.000webhost.com

Other information
Ka divergence:-0.134261KaKs divergence:-0.799449
GC content 1 (%):40GC content 2 (%):45GC content divergence:0.059
Length 1 (bp):1341Length 2 (bp):1371Length divergence:0.011
MFE 1 (kcal):-338.54MFE 2 (kcal):-374.27MFE divergence0.05