Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G11090-AT4G23790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TRICHOME BIREFRINGENCE-LIKE 23
Function (paralog2):TRICHOME BIREFRINGENCE-LIKE 24

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.6278264401808
Log2 mRNA fold difference:0.49701313164246
Log2 TE fold difference:0.090284455370913
Sequences
Protein sequence

MKLKWESISNLQQNTYLIKLVAATLITCLAFRFFVFRFGQFSPVQVSVTGNSNSQISPTS
VILSDNEDQIPVDIEVEKCDLFTGKWIKDPLGPIYTNESCGIVVDAHQNCITNGRPDSGF
LNWKWKPNDCSLPRFDSLRFLQLMRNKSWAIIGDSIARNHVESLLCMLSTVEKPVEVYHD
ENYRSKRWHFPSYNFTVSNIWSPFLVQADIFEDSNGVSSAAVQLHLDKLDNTWTDLFPSL
DYAIISSGEWFLKTAVYHENANPVGCHGCPESSNMTDLGFDYAYNTSLRHVMDFIAKSKT
KGMIFFRTSIPDHFEDGEWHNGGTCKKTEPVGEEAVEMKVLNKILRDVEINQFERVVTEM
GQESENLKLLDFAGMLLTRPDGHPGPYREFRPFDKDKNATVQNDCLHWCLPGPIDHLNDV
ILEIIVNGRTGK

MKLKLSSISMNHKNVLLIKLISAILISFFAFRLFILHSSEFSPIFASVTGKFEARFLPPE
IIVPENEDLIPQDIEVEKCDLFAGKWIPDSVGPIYTNKSCGSLIDGHQNCITNGRPDLDF
LYWKWKPHDCLLPRFDPRRFLQLMRHKSWAFIGDSISRNHVESLLCMLSTIEEPVEVYHD
MEYKSKRWHFPLHNLTVSNIWSPFLVQAAIFEDSNGVSTASVQLHLDRLDETWTSLMPSF
DYAIISTGKWFLKSAIYHENAKLVGCHNCQEKPHIEELGFDYAYNASLHNVMDFLAAEDN
SKGTVFFRTSTPDHFQNGEWHSGGTCKQTEPVSDEEIEIKDVHKILKDIEIDQFKRAVRE
KTNQDGGNLKLLDFTRMLLTRPDGHPGEYRQFRPFDKDKNAKVQNDCLHWCLPGPFDYLN
DVILETIVNG

www.000webhost.com

Other information
Ka divergence:0.0453543KaKs divergence:0.496803
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1299Length 2 (bp):1293Length divergence:-0.002
MFE 1 (kcal):-378.99MFE 2 (kcal):-361.4MFE divergence-0.024