Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G11140-AT4G23750
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cytokinin response factor 1
Function (paralog2):cytokinin response factor 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.075533237433
Log2 mRNA fold difference:1.5344057607376
Log2 TE fold difference:0.12458338648289
Sequences
Protein sequence

METEKKVSLPRILRISVTDPYATDSSSDEEEEVDFDALSTKRRRVKKYVKEVVLDSVVSD
KEKPMKKKRKKRVVTVPVVVTTATRKFRGVRQRPWGKWAAEIRDPSRRVRVWLGTFDTAE
EAAIVYDNAAIQLRGPNAELNFPPPPVTENVEEASTEVKGVSDFIIGGGECLRSPVSVLE
SPFSGESTAVKEEFVGVSTAEIVVKKEPSFNGSDFSAPLFSDDDVFGFSTSMSESFGGDL
FGDNLFADMSFGSGFGFGSGSGFSSWHVEDHFQDIGDLFGSDPVLTV

MEAEKKMVLPRIKFTEHKTNTTTIVSELTNTHQTRILRISVTDPDATDSSSDDEEEEHQR
FVSKRRRVKKFVNEVYLDSGAVVTGSCGQMESKKRQKRAVKSESTVSPVVSATTTTTGEK
KFRGVRQRPWGKWAAEIRDPLKRVRLWLGTYNTAEEAAMVYDNAAIQLRGPDALTNFSVT
PTTATEKKAPPPSPVKKKKKKNNKSKKSVTASSSISRSSSNDCLCSPVSVLRSPFAVDEF
SGISSSPVAAVVVKEEPSMTTVSETFSDFSAPLFSDDDVFDFRSSVVPDYLGGDLFGEDL
FTADMCTDMNFGFDFGSGLSSWHMEDHFQDIGDLFGSDPLLAV

Other information
Ka divergence:-0.205681KaKs divergence:-0.112837
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):864Length 2 (bp):1032Length divergence:0.089
MFE 1 (kcal):-297.91MFE 2 (kcal):-339.38MFE divergence0.065