Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G11220-AT4G23630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):VIRB2-interacting protein 2
Function (paralog2):VIRB2-interacting protein 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.0470909612135
Log2 mRNA fold difference:2.5446203749492
Log2 TE fold difference:0.54753863440825
Sequences
Protein sequence

MADEHKHEESSPNLDPAVEVVERESLMEKLSEKIHHKGDSSSSSSSDDENEKKSSSSSPK
SLKSKVYRLFGRERPVHKVLGGGKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLT
LLCHVMIVALAVLFLWSNATMFIHKSPPKIPEVHIPEEPLLQLASGLRIEINRGISSLRE
IASGRDIKKFLSAIAGLWVLSILGGCYSFLTLAYIALVLLFTVPLFYDKYEDKVDSYGEK
AMAELKKQYAVLDAKVFSKIPRGPLKDKKKD

MAEEHKHDESVIAPEPAVEVVERESLMDKISEKIHHGGDSSSSSSSSDDEDEKKKTKKPS
SPSSSMKSKVYRLFGREQPVHKVLGGGKPADIFMWKNKKMSGGVLGGATAAWVVFELMEY
HLLTLLCHVMIVVLAVLFLWSNATMFINKSPPKIPEVHIPEEPILQLASGLRIEINRGFS
SLREIASGRDLKKFLIAIAGLWVLSILGGCFNFLTLAYIALVLLFTVPLAYDKYEDKVDP
LGEKAMIELKKQYAVLDEKVLSKIPLGPLKNKKKD

www.000webhost.com

Other information
Ka divergence:0.0685152KaKs divergence:-0.999806
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):816Length 2 (bp):828Length divergence:0.007
MFE 1 (kcal):-244.7MFE 2 (kcal):-266.43MFE divergence0.043