Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G11260-AT4G23570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phosphatase-related
Function (paralog2):phosphatase-related

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.8447791759941
Log2 mRNA fold difference:-1.9239825332216
Log2 TE fold difference:0.11751097801999
Sequences
Protein sequence

MAKELAEKAKEAFLDDDFDVAVDLYSKAIDLDPNCAAFFADRAQANIKIDNFTEAVVDAN
KAIELEPTLAKAYLRKGTACMKLEEYSTAKAALEKGASVAPNEPKFKKMIDECDLRIAEE
EKDLVQPMPPSLPSSSTTPLATEADAPPVPIPAAPAKPMFRHEFYQKPEEAVVTIFAKKV
PKENVTVEFGEQILSVVIDVAGEEAYHLQPRLFGKIIPEKCRFEVLSTKVEIRLAKAEII
TWASLEYGKGQSVLPKPNVSSALSQRPVYPSSKPAKDWDKLEAEVKKQEKDEKLDGDAAM
NKFFSDIYSSADEDMRRAMNKSFAESNGTVLSTNWKEVGTKKVESTPPDGMELKKWEY

MAKELADKAKEAFVDDDFDVAVDLYSKAIDLDPNCAEFFADRAQAYIKLESFTAEAVADA
NKAIELDPSLTKAYLRKGTACMKLEEYRTAKTALEKGASITPSESKFKKLIDECNFLITE
EEKDLVQPVPSTLPSSVTAPPVSELDVTPTAKYRHEYYQKPEEVVVTVFAKGIPKQNVNI
DFGEQILSVVIEVPGEDAYYLQPRLFGKIIPDKCKYEVLSTKIEICLAKADIITWASLEH
GKGPAVLPKPNVSSEVSQRPAYPSSKKVKDWDKLEAEVKKQEKDEKLEGDAALNKFFREI
YQNADEDMRRAMSKSFVESNGTVLSTNWQEVGTKTIESTPPDGMELKKWEI

www.000webhost.com

Other information
Ka divergence:0.00692562KaKs divergence:0.999821
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1077Length 2 (bp):1056Length divergence:-0.01
MFE 1 (kcal):-333.5MFE 2 (kcal):-318.64MFE divergence-0.023