Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G11350-AT4G23490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF604)
Function (paralog2):Protein of unknown function (DUF604)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.98713111922639
Log2 mRNA fold difference:-0.85306639264171
Log2 TE fold difference:1.5062517502802
Sequences
Protein sequence

MKGNQKDSSEKPIWDRSSSGISMTRPGRLIIWLILFISVTYIIYTLKIVSTTHPCEDLTS
ESILQQRPEKKAVTVTVKAVPAEQEATDLNHVVFGIAASSKLWKQRKEYIKIWYKPKKMR
GYVWLDEEVKIKSETGDQESLPSVRISGDTSSFPYTNKQGHRSAIRISRIVSETLMSLDS
ESKKNVRWFVMGDDDTVFVTDNLIRVLRKYDHEQMYYIGSLSESHLQNIIFSYGMAYGGG
GFAISYPLAVALSKMQDQCIQRYPALYGSDDRMQACMAELGVPLTKEIGFHQYDVHGNLF
GLLAAHPITPFVSMHHLDVVEPIFPNMTRVRAIKKLTTPMKIDSAALLQQSICYDKHKSW
TISVSWGFAVQVFRGSFSPREMEMPSRTFLNWYKRADYTAYAFNTRPVSRNHCQKPFVFH
MSSAKFDPQLNTTVSEYTRHRVPQPACRWDMANPEEINTIVVYKKPDPHLWNRSPRRNCC
RVLQTKRNNTLWINVGVCRAGEVTEVK

MKGNQKDSSEKPIWDRSSSSTSIPGMWSLTRPGPKLMVWLICFIVFTYIIYMLKLVSTSR
SCDDSTSFTTVSALSTNVSSNVSSLSTSLASRRRNWEEEEEDTVVDKLTDLNHVVFGIAA
SSKLWKQRKEYIKIWYKPKRMRGYVWLDKEVKKSLSDDDDEKLLPPVKISGGTASFPYTN
KQGQRSALRISRIVSETLRLGPKNVRWFVMGDDDTVFVIDNLIRVLRKYDHEQMYYIGSL
SESHLQNIFFSYGMAYGGGGFAISYPLAKALSKMQDRCIQRYPALYGSDDRMQACMAELG
VPLTKELGFHQYDVYGNLFGLLAAHPVTPFVSMHHLDVVEPIFPNMTRVRALKKITEPMK
LDSAGLLQQSICYDKHKSWTISVSWGYAVQIFRGIFSPREMEMPSRTFLNWYKRADYTAY
AFNTRPVSRNPCQKPFVFYMSSTKFDQQLNTTVSEYTIHRVSHPSCRWKMTNPAEINTIV
VYKKPDPHLWERSPRRNCCRVLQTKRNNTLWINVGVCRAGEVTEVK

www.000webhost.com

Other information
Ka divergence:-0.236576KaKs divergence:-0.375595
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1524Length 2 (bp):1581Length divergence:0.018
MFE 1 (kcal):-449.9MFE 2 (kcal):-497.7MFE divergence0.05