Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G11380-AT4G23460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Adaptin family protein
Function (paralog2):Adaptin family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.48577505953939
Log2 mRNA fold difference:-1.4986910457169
Log2 TE fold difference:0.97867262810495
Sequences
Protein sequence

MSGHDSKYFSTTKKGEIPELKEELNSQYKCDDSVHFSVTDWDIVTLVKLRLDKRKDAVKK
VIAAMTVGKDVSSLFTDVVNCMQTENLELKKLVYLYLINYAKSQPDLAILAVNTFVKDSQ
DPNPLIRALAVRTMGCIRVDKITEYLCDPLQKCLKDDDPYVRKTAAICVAKLFDINAELV
EDRGFLEALKDLISDNNPMVVANAVAALAEIQENSSSPIFEINSTTLTKLLTALNECTEW
GQVFILDALSKYKAADPREAENIVERVTPRLQHANCAVVLSAVKMILQQMELITSTDVIR
NLCKKMAPPLVTLLSAEPEIQYVALRNINLIVQKRPTILAHEIKVFFCKYNDPIYVKMEK
LEIMIKLASDRNIDQVLLEFKEYATEVDVDFVRKAVRAIGRCAIKLERAAERCISVLLEL
IKIKVNYVVQEAIIVIKDIFRRYPNTYESIIATLCESLDTLDEPEAKASMIWIIGEYAER
IDNADELLESFLENFPEEPAQVQLQLLTATVKLFLKKPTEGPQQMIQVVLNNATVETDNP
DLRDRAYIYWRLLSTDPEAAKDVVLAEKPVISDDSNQLDPSLLDELLTNISTLSSVYHKP
PEAFVTRLKTTVQKTEDEDFAEGSEAGYSSSNPVDSAASPPGNIPQPSGRQPAPAVPAPV
PDLLGDLMGLDNAAIVPVDDPITQSGPPLPVVVPASSGQGLQISAQLSRKDGQVFYSMLF
ENNSQSVLDGFMIQFNKNTFGLAAAGSLQIPPLHPATSARTMLPMVLFQNMSAGPPSSLL
QVAVKNNQQPVWYFTDKIILHALFGEDGRMERGTFLETWRSLPDSNEVLKEFPGITITSV
ESTIELLTAFNMFFIAKRKNGNQDVIYLSAKDPRDVPFLIELTAMVGQPGLKCAVKTPTP
EIAPLFFEALELLFKA

MSGHDSKYFSTTKKGEIPELKEELNSQYKDKRKDAVKKVIAAMTVGKDVSSLFTDVVNCM
QTENLELKKLVYLYLINYAKSQPDLAILAVNTFVKDSQDPNPLIRALAVRTMGCIRVDKI
TEYLCDPLQKCLKDDDPYVRKTAAICVAKLFDINAELVEDRGFLEALKDLISDNNPMVVA
NAVAALAEIQENSTSPIFEINSTILTKLLTALNECTEWGQVFILDALSRYKASDPREAEN
IVERVTPRLQHANCAVVLSAVKMILQQMELITSTDVIRNLCKKMAPPLVTLLSAEPEIQY
VALRNINLIVQKRPTILAHEIKVFFCKYNDPIYVKMEKLEIMIKLASDRNIDQVLLEFKE
YATEVDVDFVRKAVRAIGRCAIKLERAAERCISVLLELIKIKVNYVVQEAIIVIKDIFRR
YPNTYESIIATLCESLDTLDEPEAKASMIWIIGEYAERIDNADELLESFLENFPEEPAQV
QLQLLTATVKLFLKKPTEGPQQMIQVVLNNATVETDNPDLRDRAYIYWRLLSTDPEAAKD
VVLAEKPVITDDSNQLDPSLLDELLANISTLSSVYHKPPEAFVTRLKTTVQKTEDEDYVE
GSETGYPEASGNPVDGAASPSATTGYVTKLAAAPAPVPDLLGDLMGSDNAAIVPVDEPTT
PSGRPLPVVLPASKGQGLQISAQLTRQDGQVFYSMLLENNSQSLLDGFMIQFNKNSFGLA
AVGSLQVPPLQPGASARTMMPMVLSQNMSTGSTSSVLQVAVKNNQQPVWYFEDKIVLNAL
FSEDGRMERGTFLETWKSLPDSNEVQKEFPGITITSVESTLDLLAASNMFFIAKRKNGNQ
DVLYLSAKVPRGIPFLIELTAIVGQPGLKCAVKTPTPEIAPLFFEAVEILFKA

Other information
Ka divergence:-0.00273493KaKs divergence:0.0576725
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2751Length 2 (bp):2682Length divergence:-0.013
MFE 1 (kcal):-809.23MFE 2 (kcal):-806.16MFE divergence-0.002