Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G11740-AT4G23040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ubiquitin-like superfamily protein
Function (paralog2):Ubiquitin-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0056247602521
Log2 mRNA fold difference:-0.62003160764432
Log2 TE fold difference:-0.33280604118509
Sequences
Protein sequence

MATPNQEAIDTFISITGASDAVALQKLEEHRGDLNQAVNAYFSEGDRNVVREAPVNDDDE
MDIDDVIPAPQSPLSMFNAARTIGRPPFSLLDSDFARRVFDSDPLMPRPPFVSHPREVRQ
IPIEVKDSSGPSGRSSDAPTIEDVTETAHVQGPVTTQGTVIIDEESDDDIPFAPMGRSRQ
DRPAGSVANNNNQDYNDIEEEMIRAAIEASKKEAEGSSNPLLEERPLHMEDDDDIAIAVT
MSLKSAEEEVLRSQGYKASTSEIGASAVTAAQGPQDTQALNGRLAAPSSPFDDDSDDVDE
QPLVRHRPRRAASGSLAPPNADRSRSGSPEEEHASINPAERGSGFPSEWGGISSEEHDEA
VMLEAAMFGGIPETGYNHLPFLPPQPRAQPRPPSPSLTAQRLIREQQDDEYVASLQADRD
KEMKSIRDAEARQLEEETARKAFLEEEKKKEEEAQRKLEEEQELERQLDAKEASLPKEPQ
ADEENAITLLIRMPDGTRRGRRFLKSDKLQTLFNFIDIARVVKPNTYRLVRPYPRHAFGD
GESESTLNDLGLTSKQEALFLELI

MATPTQEAIDTFMTITGSSNAVAVRKLEEYRGNLNRAVNAYFTHGDQNSYDAMDIDDGVT
PVLSEARTTDPFPLRDPNFGRSLFDNDPVMSRPPFVSHPREAREIPIEVKDSNGPSGQSN
DAPTIEDVTETAQAHGPAAQEAVIIDEVSDDDNQSAPTGQSRHAVPVGSAENNMQHYNDI
EEQIIRAAIEASKMETGDDVTKSVTVQSAEREVLRSEGWKASSSEREASEMVSIPVQQGS
RASNGRFAAPSSLSEDDDDDDDDDPDYVEEEEEPLVSHRPRRAVSGSRSSLNDDLPRSPE
AEDATIHSPGAGNGFPSEWGGISSEEHDEAIMLEAAMFGGISESEYGVPYAHYPQRTQRP
PSPSLTAQRLIREQQDDEYLASLEADRVKAEARRLEEEAARVEAIEEAKRKEEEARRKVE
EEQELERQLVSKEASLPQEPPAGEENAITLQVRLPDGTRHGRRFFKSDKLQSLFDFIDIC
RVVKPNTYRLVRPYPRRAFGDGECSSTLNDIGLTSKQEALFLELI

www.000webhost.com

Other information
Ka divergence:0.294662KaKs divergence:0.33279
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1695Length 2 (bp):1578Length divergence:-0.036
MFE 1 (kcal):-525.82MFE 2 (kcal):-513.84MFE divergence-0.012