Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G11830-AT4G11840
Species:Arabidopsis
Duplication type:TD
Function (paralog1):phospholipase D gamma 2
Function (paralog2):phospholipase D gamma 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.0016071105047196
Log2 mRNA fold difference:-0.24037808704189
Log2 TE fold difference:0.1386142035963
Sequences
Protein sequence

MSMGGGSNHEFGQWLDQQLVPLATSSGSLMVELLHGNLDIWVKEAKHLPNMICYRNKLVG
GISFSELGRRIRKVDGEKSSKFTSDPYVTVSISGAVIGRTFVISNSENPVWMQHFDVPVA
HSAAEVHFVVKDNDPIGSKIIGVVGIPTKQLCSGNRIEGLFPILNSSGKPCRKGAMLSLS
IQYTPMERMRLYQKGVGSGVECVGVPGTYFPLRKGGRVTLYQDAHVDDGTLPSVHLDGGI
QYRHGKCWEDMADAIRRARRLIYITGWSVFHPVRLVRRNNDPTEGTLGELLKVKSQEGVR
VLVLVWDDPTSMSFPGFSTKGLMNTSDEETRRFFKHSSVQVLLCPRYGGKGHSFIKKSEV
ETIYTHHQKTMIVDAEAAQNRRKIVAFVGGLDLCNGRFDTPKHSLFGTLKTLHKDDFHNP
NFVTTEDVGPREPWHDLHSKIDGPAAYDVLANFEERWMASKPRGIGKGRTSFDDSLLRIN
RIPDIMGLSEASSANDNDPESWHVQVFRSIDSTSVKGFPKDPEEATGRNLLCGKNILIDM
SIHAAYVKAIRSAQHFIYIENQYFLGSSFNWDSNKDLGANNLIPMEIALKIANKIRAREN
FAAYIVIPMWPEGAPTSKPIQRILYWQHKTMQMMYQTIYKALLEVGLDGQLEPQDFLNFF
CLGNREVGTREVPDGTVNVYNCPRKPPQPNAAQVQALKSRRFMIYVHSKGMVVDDEFVLI
GSANINQRSLEGTRDTEIAMGGYQPHHSWAKKGSRPRGQIFGYRMSLWAEHLGFLEQEFE
EPENMECVRRVRQLSELNWGQYAAEEVTEMSGHLLKYPVQVDKTGKVSSLPGCETFPDLG
GKIIGSFLTLQENLTI

MAYHPVYNETMSMGGGSSNEFGQWLDKQLVPFDTSSGSLRVELLHGNLDIWVKEAKHLPN
MDGFHNTLVGGMFFGLGRRNHKVDGENSSKITSDPYVTVSISGAVIGRTFVISNSENPVW
MQHFDVPVAHSAAKVHFVVKDSDIIGSQIIGAVEIPTEQLCSGNRIEGLFPILNSRGKPC
KQGAVLSLSIQYIPMERMRLYQKGVGFGVECVGVPGTYFPLRKGGRVTLYQDAHVDDGTL
PSVHLDGGIQYRHGKCWEDMADAIRRARRLIYITGWSVFHPVRLVRRNNDPTQGTLGELL
KVKSQEGVRVLVLVWDDPTSRSLLGFSTKGLMNTSDEETRRFFKHSSVQVLLCPRYGGKG
HSFIKKSEVETIYTHHQKTMIVDAEAAQNRRKIVAFVGGLDLCNGRFDTPKHPLFRTLKT
IHKDDFHNPNFVTTADDGPREPWHDLHSKIDGPAAYDVLANFEERWMKASKPRGIGRLRT
SSDDSLLRLDRIPDIMGLSEASSANDNDPESWHVQVFRSIDSSSVKGFPKDPKEATGRNL
LCGKNILIDMSIHAAYVKAIRSAQHFIYIENQYFLGSSFNWDSNKNLGANNLIPMEIALK
IANKIRAREKFAAYIVIPMWPEGAPTSNPIQRILYWQHKTMQMMYQTIYKALVEVGLDGQ
LEPQDFLNFFCLGTREVGTREVPDGTVSVYNSPRKPPQLNAAQVQALKSRRFMIYVHSKG
MVVDDEFVLIGSANINQRSLEGTRDTEIAMGGYQPHHSWAKKGSRPRGQIFGYRMSLWAE
HLGFLEQEFEEPENMECVRRVRQLSELNWRQYAAEEVTEMPGHLLKYPVQVDRTGKVSSL
PGYETFPDLGGKIIGSFLVVEENLTI

Other information
Ka divergence:-0.259232KaKs divergence:0.0737622
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):2571Length 2 (bp):2601Length divergence:0.006
MFE 1 (kcal):-800.11MFE 2 (kcal):-804.08MFE divergence0.002