Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G11960-AT4G22890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PGR5-like B
Function (paralog2):PGR5-LIKE A

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:4.2643671644844
Log2 mRNA fold difference:3.9665213594267
Log2 TE fold difference:0.37116168786914
Sequences
Protein sequence

MAFTLTIPRFSAISRKPITCSSSRTQCPAPFTHGRSISLRRRLTLLPLKASTDQSGQVGG
EEVDSKILPYCSINKNEKRTIGEMEQEFLQAMQSFYYEGKAIMSNEEFDNLKEELMWEGS
SVVMLSSDEQRFLEASMAYVSGNPILSDEEYDKLKMKLKMDGSEIVCEGPRCSLRSKKVY
SDLAIDYFKMFLLNVPATVVALGLFFFLDDITGFEITYLLELPEPFSFIFTWFAAVPAIV
YLALSLTKLILKDFLILKGPCPNCGTENVSFFGTILSIPNDSNTNNVKCSGCGTEMVYDS
GSRLITLPEGGKA

MGSKMLFSLTSPRLFSAVSRKPSSSFSPSPPSPSSRTQWTQLSPGKSISLRRRVFLLPAK
ATTEQSGPVGGDNVDSNVLPYCSINKAEKKTIGEMEQEFLQALQSFYYDGKAIMSNEEFD
NLKEELMWEGSSVVMLSSDEQRFLEASMAYVSGNPILNDEEYDKLKLKLKIDGSDIVSEG
PRCSLRSKKVYSDLAVDYFKMLLLNVPATVVALGLFFFLDDITGFEITYIMELPEPYSFI
FTWFAAVPVIVYLALSITKLIIKDFLILKGPCPNCGTENTSFFGTILSISSGGKTNTVKC
TNCGTAMVYDSGSRLITLPEGSQA

Other information
Ka divergence:0.195223KaKs divergence:0.214847
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):942Length 2 (bp):975Length divergence:0.017
MFE 1 (kcal):-249.28MFE 2 (kcal):-279.5MFE divergence0.057