Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G12000-AT4G22850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SNARE associated Golgi protein family
Function (paralog2):SNARE associated Golgi protein family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.80827997658599
Log2 mRNA fold difference:-0.85316388964367
Log2 TE fold difference:-0.11959081185194
Sequences
Protein sequence

MTYHEEDDTVSEFRVRVEEDGVDKLGHYVKLTEDFEVHRQETEQESSSSPSSSSSCGQKR
SVWFWIKLGLFFTFLTALGLAGYKWLYPLIMDKELIPLIKWEMETFTHPVCGILVFASVS
LFPVILIPTTPSMWVAGITFGYFYGLLLTLPAVAIGVSLPYFISYLFLNKIQGWLERYPD
QAAMLRAAGGGSWFHQFRAVTLIRISPFPFAVYNYCAVATRVKFGPYMAGSLVGMAPEIF
VAIYTGILIRTLADASTAEQKGLSILQIVLNIFGFVATVVTTVLITKYAKRQLEVMKKEK
EALLLQ

MTVTEDEKPVLELLVRVEDDDEKGPYVKLSEVLEKGQESEQEKEEEKTDSSRFWFWVKLS
LLFAFLAALAVVGYIWIGPLIMDKELIPLIQWEIRTFTHPVCGLLVFASVAIFPTILLPS
TPSMWIAGMTFGYGYGFLLIISAAAVGVSLPYFIGQLFCHKIQGWLERYPDQAAVLRAAG
EGNWLHQFLLVTLIRISPFPYILYNYCSVATRVKYGPYITGSLLGMVPEVFVAIYTGILV
RTLAEASSAEEQGLSVTQVILNILGFLATVATTILITKYAKRQLETMKKEDEALLQ

www.000webhost.com

Other information
Ka divergence:-0.171312KaKs divergence:-0.124043
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):921Length 2 (bp):891Length divergence:-0.017
MFE 1 (kcal):-257MFE 2 (kcal):-260.1MFE divergence0.006