Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G12040-AT4G22820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):A20/AN1-like zinc finger family protein
Function (paralog2):A20/AN1-like zinc finger family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.40018781346576
Log2 mRNA fold difference:-0.41432723738358
Log2 TE fold difference:0.019403732885219
Sequences
Protein sequence

MGSEENNSTSFPPTEPKLCDNGCGFFGSPSNMNLCSKCYRSLRAEEDQTAVAKAAVKNSL
KLPSCSIIAPGQKHPLEIKPAHLETVVVTAEPSSVPVAAEQDEAEPSRPVRPNNRCFSCN
KKVGVMGFKCKCGSTFCGSHRYPEKHECSFDFKEVGRDAIAKANPLVKADKVQRI

MGSEQNDSTSFTQSQASEPKLCVKGCGFFGSPSNMDLCSKCYRGICAEEAQTAVAKAAVE
KSFKPSPPRSLFIAEPPAVVVEPKPEKAAVVVVSAEPSSSAVPEANEPSRPARTNRCLCC
NKKVGIMGFKCKCGSTFCGEHRYPETHDCSFDFKEVGRGEIAKANPVVKADKIQRF

www.000webhost.com

Other information
Ka divergence:0.0888103KaKs divergence:0.0247046
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):528Length 2 (bp):531Length divergence:0.003
MFE 1 (kcal):-173.22MFE 2 (kcal):-174.9MFE divergence0.005