Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G12080-AT4G22770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AT-hook motif nuclear-localized protein 1
Function (paralog2):AT hook motif DNA-binding family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.34808724715656
Log2 mRNA fold difference:-0.30024781236621
Log2 TE fold difference:0.54170030708853
Sequences
Protein sequence

MVLNMESTGEAVRSTTGNDGGITVVRSDAPSDFHVAQRSESSNQSPTSVTPPPPQPSSHH
TAPPPLQISTVTTTTTTAAMEGISGGLMKKKRGRPRKYGPDGTVVALSPKPISSAPAPSH
LPPPSSHVIDFSASEKRSKVKPTNSFNRTKYHHQVENLGEWAPCSVGGNFTPHIITVNTG
EDVTMKIISFSQQGPRSICVLSANGVISSVTLRQPDSSGGTLTYEGRFEILSLSGSFMPN
DSGGTRSRTGGMSVSLASPDGRVVGGGLAGLLVAASPVQVVVGSFLAGTDHQDQKPKKNK
HDFMLSSPTAAIPISSAADHRTIHSVSSLPVNNNTWQTSLASDPRNKHTDINVNVT

METTGEVVKTTTGSDGGVTVVRSNAPSDFHMAPRSETSNTPPNSVAPPPPPPPQNSFTPS
AAMDGFSSGPIKKRRGRPRKYGHDGAAVTLSPNPISSAAPTTSHVIDFSTTSEKRGKMKP
ATPTPSSFIRPKYQVENLGEWSPSSAAANFTPHIITVNAGEDVTKRIISFSQQGSLAICV
LCANGVVSSVTLRQPDSSGGTLTYEGRFEILSLSGTFMPSDSDGTRSRTGGMSVSLASPD
GRVVGGGVAGLLVAATPIQVVVGTFLGGTNQQEQTPKPHNHNFMSSPLMPTSSNVADHRT
IRPMTSSLPISTWTPSFPSDSRHKHSHDFNITLT

Other information
Ka divergence:0.340853KaKs divergence:0.47135
GC content 1 (%):48GC content 2 (%):50GC content divergence:0.02
Length 1 (bp):1071Length 2 (bp):1005Length divergence:-0.032
MFE 1 (kcal):-342.47MFE 2 (kcal):-334.63MFE divergence-0.012