Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G12110-AT4G22753
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):sterol-4alpha-methyl oxidase 1-1
Function (paralog2):sterol 4-alpha methyl oxidase 1-3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.2184718206452
Log2 mRNA fold difference:0.65291684914738
Log2 TE fold difference:-0.74717432009701
Sequences
Protein sequence

MIPYATVEEASIALGRNLTRLETLWFDYSATKSDYYLYCHNILFLFLVFSLVPLPLVFVE
LARSASGLFNRYKIQPKVNYSLSDMFKCYKDVMTMFILVVGPLQLVSYPSIQMIEIRSGL
PLPTITEMLSQLVVYFLIEDYTNYWVHRFFHSKWGYDKIHRVHHEYTAPIGYAAPYAHWA
EVLLLGIPTFMGPAIAPGHMITFWLWIALRQMEAIETHSGYDFPWSPTKYIPFYGGAEYH
DYHHYVGGQSQSNFASVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNGGIKSD

MIPYPTVEDASVALGRNLTWFETVWFDYSATKSNFHVYCHTILVLFLVFSLAPFPLVIVE
WTGWFDQFKIQKKVKYSLSDMFQCYKEVMKLFLLVVGTLQIVSYPSIQMVGIRSGLPLPS
LMEIVAQLVVYFLIEDYTNYWIHRWMHCKWGYEKIHRIHHEYTSPIGYASPYAHWAEILI
LGIPTFLGPAIAPGHIMTFWLWISLRQFEAIETHSGYDFPWSVTKLIPFYGGPEYHDYHH
YVGGQSQSNFASVFTYCDYIYGTDKGYRIHKKLLHHQIKEEAEEKRVRKHD

www.000webhost.com

Other information
Ka divergence:0.450908KaKs divergence:0.572632
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):897Length 2 (bp):876Length divergence:-0.012
MFE 1 (kcal):-236.4MFE 2 (kcal):-255.65MFE divergence0.039