Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G12300-AT4G12310
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cytochrome P450, family 706, subfamily A, polypeptide 4
Function (paralog2):cytochrome P450, family 706, subfamily A, polypeptide 5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.56597073561505
Log2 mRNA fold difference:-0.28004065550671
Log2 TE fold difference:0.75400162171101
Sequences
Protein sequence

MSPISNLFPDNTINLTPYAIVILTTVFSILWYIFKRSPQPSLPPGPRGLPIVGNLPFLDP
DLHTYFANLAQSHGPIFKLNLGSKLTIVVNSPSLAREILKDQDINFSNRDVPLTGRAATY
GGIDIVWTPYGAEWRQLRKICVLKLLSRKTLDSFYELRRKEVRERTRYLYEQGRKQSPVK
VGDQLFLTMMNLTMNMLWGGSVKAEEMESVGTEFKGVISEITRLLSEPNVSDFFPWLARF
DLQGLVKRMGVCARELDAVLDRAIEQMKPLRGRDDDEVKDFLQYLMKLKDQEGDSEVPIT
INHVKALLTDMVVGGTDTSTNTIEFAMAELMSNPELIKRAQEELDEVVGKDNIVEESHIT
RLPYILAIMKETLRLHPTLPLLVPHRPAENTVVGGYTIPKDTKIFVNVWSIQRDPNVWEN
PTEFRPERFLDNNSCDFTGANYSYFPFGSGRRICAGVALAERMVLYTLATLLHSFDWKIP
EGHVLDLKEKFGIVLKLKIPLVALPIPRFSDSNLYL

MSMLSNLFPDNAISLTPYAYAVLILTATFSILWYIFKRSPQPPLPPGPRGLPIVGNLPFL
DPDLHTYFTKLAQSHGPIFKLNLGSKLTVVVNSPSLASEILKDQDINFSNHDVPLTARAV
TYGGLDLVWLPYGAEWRMLRKVCAAKLFSRKTLDSFYELRRKEIRERTRCLYQKGLEKSP
VNVGEQLFLTMMNLMMNMLWGGSVKAEDMESVGTEFKGVISEITRLLGVPNVSDFFPMLA
RFDLQGLVKKMHLYARDLDAILDRAIEQMQRLRSRDGDDGECKDFLQHLMKLRDQEADSD
VPITMNHVKAVLMDMVVGGTESSTNTIEFVMAELISNPELMRRAQQELDEVVGKDNIVEE
SHITSLPYILAVLKETLRLYPTIPLLVPHRPSETALVGGYTIPKNTKIFINVWSIQRDPN
VWEYPTEFRPERFLDKKSCDFTGTDYSYLPFGSGRRICAGIALAERMILYTLATLLHSFD
WTIPDGHVLDLEEKFGIVLKLKTPLVALPIPRLSNSNFYF

Other information
Ka divergence:0.302773KaKs divergence:0.324426
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1551Length 2 (bp):1563Length divergence:0.004
MFE 1 (kcal):-469.62MFE 2 (kcal):-443.64MFE divergence-0.028