Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G12410-AT4G22620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAUR-like auxin-responsive protein family
Function (paralog2):SAUR-like auxin-responsive protein family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.040662403157
Log2 mRNA fold difference:1.3514359829884
Log2 TE fold difference:0.29406275918595
Sequences
Protein sequence

MKRVRGFKIGHRFVKIFKWIPRNRCPTRITNPVTGIRSLARCLSRGAKRLCGGSKKNPGQ
NQIRLGKDPKKSNRVVPRGHLVVHVGESDDDTRRVVVPVIYFNHPLFGELLEQAERVHGF
DQPGRITIPCRVSDFEKVQLRIAAWDHCRRKNSYKII

MKRLRGFKIGHRFVKIFKWIIRSRRNQTGKRQCLTGILNPVTKIYSLARRCLRRGANRLC
GGMKPGQTRLGNEPKTPTVPRGHLVVHVGESGEDTRRVVVPVIYFNHPLFGELLEQAERV
YGFEQPGRIMIPCRVSDFEKVQMRIAAWDHCRRKSTFKIL

www.000webhost.com

Other information
Ka divergence:-0.0773175KaKs divergence:-0.107101
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):474Length 2 (bp):483Length divergence:0.009
MFE 1 (kcal):-147.81MFE 2 (kcal):-163MFE divergence0.049