Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G12440-AT4G22570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):adenine phosphoribosyl transferase 4
Function (paralog2):adenine phosphoribosyl transferase 3

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.0030665071717313
Log2 mRNA fold difference:0.63672642078436
Log2 TE fold difference:-0.63143221431199
Sequences
Protein sequence

MSENEVKDPRIDGIKTKIRVVPDFPKKGIMFQDITTLLLDPKAFKDTIDLFVERYRDMNI
SVVAGIEARGFIFGSPIALAIGAKFVPLRKPKKLPGQIIFEEYELEYGSDRLEMHVEAVD
SGDRALVVDDLIATGGTLCAAMNLLKRVGAEVIECACVIELPELKGRERLEGKPLYVLVE
YR

MSGNKEEEDPRIHGIKTKIRVVPDFPKKGIMFQDITTVLLDPKAFKDTIDLFVERYRDKN
ISVVAGIEARGFLFGPPIALAIGAKFVPLRKPKKLPGETIFEEYELEYGNDRLEMHIGAV
EAGDRALVVDDLIATGGTLCAAINLLERVGAEVVECACVIELPELKGRQRLKGKPLCMLV
EYR

www.000webhost.com

Other information
Ka divergence:-0.125871KaKs divergence:0.420666
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):549Length 2 (bp):552Length divergence:0.003
MFE 1 (kcal):-156.8MFE 2 (kcal):-166.87MFE divergence0.031