Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G12460-AT4G22540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):OSBP(oxysterol binding protein)-related protein 2B
Function (paralog2):OSBP(oxysterol binding protein)-related protein 2A

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.9435504328502
Log2 mRNA fold difference:0.84463846642701
Log2 TE fold difference:0.90548900209076
Sequences
Protein sequence

MPLTRSKSLPATENGGSDRETLQSGRSVAGILYKWTNYGKGWRSRWFLLRDGILSYSKIR
RPENVNLLSPSDDLRLIGDISTDRLLRMKSCSGRSRRKHHKNIGIVHLKVSSYRESKSDH
RKFYIFTATKTLHLRTDSRSDRAAWLQALASTRGIVPLQSINGDFSFVSPKDLSISTERL
KKRLFEEGMNESLVKECEQIVDSEFCEVQEQIKLLHEERKKLLDALRQLEMANLEAEASG
IHDDVYQLRNHKYSSLGRGKYSECSTSASSDDKQEFEDISEEDEASFHDTKESFGEPDVG
SVLTHFKRRTKLPDPAEKERGVSLWSMIKDNVGKDLTRVCLPVYFNEPISSLQKCFEDLE
YSYLLDQAYEYGKSGKSLLRALNVAAFAVSGYASTEGRHCKPFNPLLGETYEADFPEKGI
RFFSEKVSHHPTVIACHCEGKGWKFWGDTNLRSKFWGRSIQLEPVGILTLEFDDGEIFQW
SKVTTTIYNILLGKLYCDHHGIMKIRGNRQYSCMLKFKEQSILDRNPHQVNGFVEDVTGK
KAATVFGKWNDSLYYVAGDGINKASASLLWKATKAPPNVTRYNFTSFAMTLNELIPGLEE
KLPPTDSRLRPDQRHLENGEYEKANEEKQRLERRQRMSRQIQESGWRPRWFEPQGESESY
KYTGGYWEARDVKSWDDCPNIFGEFTEEVADCA

MRVKELHPLCCITLESPHGINSQSPEEPVTTALTRSRSLPAKSLTGGSESETVAGILYKW
TNFGKGWRSRWFLLRNGILSYSKIRRPENLNLLSPDDDVRLIGDISGERLSRMDSCSGRR
KQQKTVGIVHLKVSSFRESKSDDRKFYIFTATKTLHLRTDSITDRAAWLQALASTKCIFP
LRSLNGDFSFIPPKDLSISTERLKKRLHEEGMNENLVKECEQIMLSEFSEMHGQVKLLHE
ERTNLLDALRQLEAANLEVGASGKHEFSSLGRGKYSECSTTASSDGKQEFEDVSEEDEPS
FHDTKEFFNEPNIGSESNLAISGHTDIKRRTKLPDPAEKEKGVSLWSMIKDNVGKDLTRV
CLPVYFNEPISSLQKCFEDLEYSYLLDRAYEHGKSGNGLLRALNVAAFAVSGYASTEGRH
CKPFNPLLGETYEADFPEKGIRFFSEKVSHHPTVIACHCEGKGWKFWGDTNLRSKFWGRS
IQVEPVGVLTLEFDDGEVFQWSKVTSTIYNIILGKLYCDHHGVMQIRGNRQYSCTLKFKE
QSILERNPHQVNGFVEDVAGQKAATIFGKWDDSLYYVAGDGINKSKVSDPASNASLLWKR
TKPPPNVTRYNLTSFAITLNELTPGLQEILPPTDSRLRPDQRHLENGEYEKANLEKQRLE
RRQRMSRQLQESGWRPRWFERQGESDTFKYTGGYWEARGHRNWDDCPDIFGEFTEELADA
A

www.000webhost.com

Other information
Ka divergence:-0.193372KaKs divergence:-0.266194
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2082Length 2 (bp):2166Length divergence:0.02
MFE 1 (kcal):-619.95MFE 2 (kcal):-670.26MFE divergence0.039