Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G12520-AT4G22460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Function (paralog2):Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-4.8118575655678
Log2 mRNA fold difference:-4.1483428170275
Log2 TE fold difference:-0.63800747031811
Sequences
Protein sequence

MASKISASLVIFLTFNILFFTLTTACGGGCSSTPKPKPKPKSTGSCPKDTLKLGVCANVL
KDLLKIQLGTPPVKPCCSLLNGLVDLEAAACLCTALKAKVLGINLNVPVSLSLLLNVCGK
KVPSGFVCA

MALKDSLALLLLFNILFFTLTTATRSTNCPPPPGKHNKQKPSPTPTTGTCPKDALKVGVC
VNALNLLNGLTPGTPPVTPCCSLIEGLVDLEAAICLCTALKASVLGINLTLPINLSLLLN
ICNREASRDFQFP

www.000webhost.com

Other information
Ka divergence:0.260958KaKs divergence:0.647059
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):390Length 2 (bp):402Length divergence:0.015
MFE 1 (kcal):-94.41MFE 2 (kcal):-89.22MFE divergence-0.028