Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G12600-AT4G22380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein
Function (paralog2):Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2915909594599
Log2 mRNA fold difference:-1.5370727354043
Log2 TE fold difference:0.31455608898538
Sequences
Protein sequence

MTVEGVNPKAYPLADSQLSITILDLVQQATNYKQLKKGANEATKTLNRGISEFIVMAADT
EPLEILLHLPLLAEDKVFEFLLIVSLSYESQLVVSLALASFTGFTWVSSSYDKKIRLYWL
LDSSFEIVIVDNVPYVFVPSKQALGRACDVTRPVIACSVTSNEASQLKSQIQHLKDAIEK
LLI

MTGEVVNPKAYPLADSQLSITIMDLVQQATNYKQLKKGANEATKTLNRGISEFVVMAADA
EPLEILLHLPLLAEDKNVPYVFVPSKQALGRACGVTRPVIACSVTSNEASQLKSQIQHLK
DAIEKLLI

Other information
Ka divergence:-0.197645KaKs divergence:0.495392
GC content 1 (%):39GC content 2 (%):42GC content divergence:0.037
Length 1 (bp):552Length 2 (bp):387Length divergence:-0.176
MFE 1 (kcal):-140.44MFE 2 (kcal):-109.61MFE divergence-0.123