Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G12770-AT4G12780
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Chaperone DnaJ-domain superfamily protein
Function (paralog2):Chaperone DnaJ-domain superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.42608291232661
Log2 mRNA fold difference:0.060107617659791
Log2 TE fold difference:0.36522018003613
Sequences
Protein sequence

MDDFTGLLARDFGLKPQGKSAPMASQSNSSAADFNTFASSYSFASAAGKKSDSLPVFDDL
GRDGDDLLFRDVFSGPPPKYGSSGDSRSPSAPAFDYDVMFKEPKSKSASSMPVYDKPVYD
DEDVFESIPELKIPSTSSQSARFENVFSSISSSPTKHRKQNSSPFDDLMGNNLGKKESDR
EEKGSSIFDDLIPGFGRTSSPPAKRTTSETTSQSQKPPYRTAETSSNVKEDPFVVLEEST
STLREPSTGGFTDPLEEIGKFNSRKTDHSSVHGGVFVDTDPLDSLGKSGPDMNSRGKSHL
RPPGNISGSQSPVESSGLYHSKNVSFDDVVEPQNTSTPPPTNSDGSFESSDDVWLTVSEI
PLFTQPTSAPPPTRPPPPRPTRPIKKKVNEPSIPTSAYHSHVPSSGRASVNSPTASQMDE
LDDFSIGRNQTAANGYPDPSSGEDSDVFSTAAASAAAMKDAMDKAEAKFRHAKERREKES
LKASRSREGDHTENYDSRERELREKQVRLDRERAEREAEMEKTQAREREEREREQKRIER
ERERLLARQAVERATREARERAATEAHAKVQRAAVGKVTDARERAERAAVQRAHAEARER
AAAGAREKAEKAAAEARERANAEVREKEAKVRAERAAVERAAAEARGRAAAQAKAKQQQE
NNNDLDSFFNSVSRPSSVPRQRTNPPDPFQDSWNKGGSFESSRPSSRVPSGPTENLRKAS
SATNIVDDLSSIFGAPASQSGGFQDVDGETEERRRARLERHQRTQERAAKALAEKNERDL
QVQREQAEKDRIGGTLDVEIRRWGAGKEGNLRALLSTLQYVLWPECGWQPVSLTDLITGA
SVKKVYRKATLCIHPDKVQQKGANLQQKYIAEKVFDMLKEAWNKFNSEELF

MDDFTGLLARDFGLKPQGKSAPMASQSNSSAADFNTFASSYSFATAAGKKSDSLPVFDDP
GRDGDDLLFKDVFSGPPPPKYGSSSGDSRSPSAPAFDYDAMFKEPKSKSASSMPVYDKPV
YDDEDVFESIPELKIPSTSSQSARFENVFSSISSSPTKHRKQNSSPFDDLMGNNLGKKGA
DSDREEKGSSIFDDLIPGFGRTSSPPSKRTTSETTNQSEKAPYRTAETSSNVEEDPFVVL
EESESTPREPSRTDPLDDIGKFNSRKTDHSSVHGGVFVDIDPLDNLGKPGPDMNSKGKSH
LRPPGNISGSQSPPVESPGSYHSKKVSFEDFLEPHNMSTPPPTNSNGSFESSDDVWLTVS
EIPLFTQPTSAPPPTRPPPPRPTRPIKKKVNEPSIPTSAYHSHVPSSGRASVNSPTASQM
DELDDFSIGRNQTAANGYPDPSSGEDSDVFSTAAASAAAMKDAMDKAEAKFRHAKERREK
ENLKASRSREGDHTENYDSRERELREKQVRLDRERAEREAEMEKAQEREKEEREREQKRI
ERERERLVARQAVERATREARERAATEAHAKVQRAAVGKATDARERAERAAVQRAHAEAR
ERAAAGARDKAAKAAAEAREKAEKAAAEAKERANAEAREKETRVRAERAAVERAAAEARG
RAAAQAKAKQQQENTNDLDSFFSSISRPNSAPRQRTNPLDPFQDSWNKGGSFESSRESLR
VPPGQPENLRKTSSVTNIVDDLSSIFGASASQSGGFQDVDGETEERRRARLERHQRTQER
AAKALAEKNERDLQVQREQVEKDRIGVTLDVEIKRWGAGKEGNLRALLSTLQYVLWPECG
WQPVSLTDLITAASVKKVYRKATLCIHPDKVQQKGANLQQKYIAEKVFDMLKEAWNKFNS
EELF

www.000webhost.com

Other information
Ka divergence:0.238674KaKs divergence:-0.916757
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):2676Length 2 (bp):2715Length divergence:0.007
MFE 1 (kcal):-876.8MFE 2 (kcal):-868.55MFE divergence-0.005