Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G13850-AT4G13860
Species:Arabidopsis
Duplication type:TD
Function (paralog1):glycine-rich RNA-binding protein 2
Function (paralog2):RNA-binding (RRM/RBD/RNP motifs) family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.087932485807
Log2 mRNA fold difference:-1.6968549393126
Log2 TE fold difference:-0.37231457240073
Sequences
Protein sequence

MAFCNKLGGLLRQNISSNGNVPVTSMLGSLRLMSTKLFIGGLSWGTDDASLRDAFAHFGD
VVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPANDRPSAPRA
YGGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGGF

MATRVYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAA
VSGMDGKELNGRRVSVKLFGIGDIDDE

www.000webhost.com

Other information
Ka divergence:0.592156KaKs divergence:-0.999427
GC content 1 (%):49GC content 2 (%):46GC content divergence:-0.032
Length 1 (bp):477Length 2 (bp):264Length divergence:-0.287
MFE 1 (kcal):-149.53MFE 2 (kcal):-76.5MFE divergence-0.323