Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G13890-AT4G13930
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Pyridoxal phosphate (PLP)-dependent transferases superfamily protein
Function (paralog2):serine hydroxymethyltransferase 4

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:4.0467349886563
Log2 mRNA fold difference:3.8121768950174
Log2 TE fold difference:-0.061231396722114
Sequences
Protein sequence

MEPVYSWGNTHLDFVDPEIYDLIEKEKHRQCRGIELIAAENFTSVAVMEALGSCLTNKYS
EGMPGNRYYGGTEFIDEIESLCRSRSLEAFHCNPEKWGVNVQPYSGSPANFAAYTALLQP
HDRIMGLDLPSGGHITHGYYSSGGKNISATSIYFENLPYKVDSKTGYIDYDKLEEKAMDF
RPKLIICGGTSYPREWDYARFRAVADKVGAFLLCDMAHNSALVAAQEAADPFEYCDVVTT
STHKSLRGPRAGMIFYRKGPKPAKKGQPEGEVYDFDAKINSAVFPALQSGPHNNKIGALA
VALKQVMAPSFKVYAKQVKANAACLASYLINKGYTLVTDGTDNHLILWDLRPLGLTGNKV
EKVCELCYITLNRNAVFGDTSFLAPGGVRIGTPAMTSRGLVEKDFEKIGEFLHRAVTITL
DIQEQYGKVMKDFNKGLVNNKEIDEIKADVEEFTYDFDMPGFFISESRND

MEPVSSWGNTSLVSVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYS
EGIPGNRYYGGNEFIDEIENLCRSRALEAFHCDPAAWGVNVQPYSGSPANFAAYTALLQP
HDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVNFTTGYIDYDKLEEKALDF
RPKLLICGGSAYPRDWDYARFRAIADKVGALLLCDMAHISGLVAAQEAANPFEYCDVVTT
TTHKSLRGPRAGMIFYRKGPKPPKKGQPEGAVYDFEDKINFAVFPALQGGPHNHQIGALA
VALKQANTPGFKVYAKQVKANAVALGNYLMSKGYQIVTNGTENHLVLWDLRPLGLTGNKV
EKLCDLCSITLNKNAVFGDSSALAPGGVRIGAPAMTSRGLVEKDFEQIGEFLSRAVTLTL
DIQKTYGKLLKDFNKGLVNNKDLDQLKADVEKFSASYEMPGFLMSEMKYKD

www.000webhost.com

Other information
Ka divergence:-0.599795KaKs divergence:-0.460426
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1413Length 2 (bp):1416Length divergence:0.001
MFE 1 (kcal):-454.62MFE 2 (kcal):-472.11MFE divergence0.019