Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G14030-AT4G14040
Species:Arabidopsis
Duplication type:TD
Function (paralog1):selenium-binding protein 1
Function (paralog2):selenium-binding protein 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.6010308156373
Log2 mRNA fold difference:1.2476631826624
Log2 TE fold difference:0.40143497814669
Sequences
Protein sequence

MATETEVVAPVTVSNGGSKGCCKYGGPGYATPLAAMSGPSEKLIYVTAVYTGTGIDKPDY
LATVDVDPSSPSYSSVIHRLPMPFVGDELHHSGWNSCSSCHGDASVDRRYLVLPSLISGR
IYAIDTKENPRAPSLYKYVDPKEIADKTGLAFPHTAHCLATGEILVSCLGDEEGNAKGNG
FLLLDSDFNIKNRWEKPGHSPLYGYDFWYQPRHKTMISTSWGAPKAFSKGFNLQHVADGL
YGSHLHVYSWPGGEIKQLIDLGPTGLLPLEIRFLHDPSKDTGFVGSALSSNMIRFFKNSD
ETWSHEVVISVKPLKVENWILPEMPGLITDFLISLDDRFIYFVNWLHGDIRQYNIEDPKN
PVLTGQIWVGGLLQKGSPVKAVGEDGNTFQFEVPQIKGKSLRGGPQMIQLSLDGKRLYAT
NSLFSAWDRQFYPEIMEKGSHIIQIDVDTEKGGLTINPDFFVDFGDEPDGPSLAHEMRYP
GGDCTSDIWI

MATETVLATAVSNGKSKGCCKSGPGYATPLAAMAGPREKLIYVTALYSGTGRDKPDYLAT
VDVDPSSPTFSSVIHRLKMPYIGDELHHTGWNSCSSCHGDASADRRYLVLPGLISGRIYA
IDTKTDPKAPSLYKVVEPKEIAEKTGLAFPHTSHCLASGDMLVSCLGDKEGNAKGNGFLL
LDSDFNVKSRWDKPGHGPLFGYDFWYQPRFKTMISTSWGAPKAFSKGFNLQHVADGLYGS
HLHIYQWPEGEMKQIIDLGNTGLLPLEIRFLHDPSKDTGYVGSALSSNMIRFFKNSDDTW
SHEVVISVKPLKVENWILPEMPGLITDFLISLDDRFFYFVNWLHGDIRQYNIEDPKNPVL
TGQIWVGGLLQKGSPYKAVGEDGNTYQFDVPQIKGKSLRAGPQMIQLSLDGKRLYATNSL
FSAWDRQFYPEIMEKGSHIIQIDVDTDKGGLTLNPDFFVDFGDEPDGPALAHEMRYPGGD
CTSDIWI

Other information
Ka divergence:0.219088KaKs divergence:-0.366638
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):1473Length 2 (bp):1464Length divergence:-0.003
MFE 1 (kcal):-487.32MFE 2 (kcal):-477.01MFE divergence-0.011