Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G14230-AT4G14240
Species:Arabidopsis
Duplication type:TD
Function (paralog1):CBS domain-containing protein with a domain of unknown function (DUF21)
Function (paralog2):CBS domain-containing protein with a domain of unknown function (DUF21)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.62945968863423
Log2 mRNA fold difference:-0.9222785214314
Log2 TE fold difference:0.35888615967154
Sequences
Protein sequence

MHPINAVVAARMLAGISQSNALQSEAIPFGSLEWITYAGISCFLVLFAGIMSGLTLGLMS
LGLVELEILQRSGTPKEKKQSAAIFPVVQKQHQLLVTLLLFNALAMEGLPIYLDKIFNEY
VAIILSVTFVLFVGEVIPQAICTRYGLAVGANLVWLVRILMVLSYPISFPIAKMLDWVLG
HNDPLFRRAQLKALVSIHGEAAGKGGELTHDETTIISGALDLTEKTAQEAMTPIESTFSL
DVNSKLDREAMDKIQARGHSRVPVYSDNPKNVIGLLLVKSLLTVRPETGTLVSAVGIRRI
PRVPANMPLYDILNEFQKGSSHMAAVVKVKGKSKGHPSTLHEENSGESNVSSNNSELTAP
LLLKREGNHDSVIVRIDKANGQSFISEAGRQGFSHTSEEIEDGDVIGIITLEDVFEELLQ
EEIVDETDEYIDVHKRIRVATVAAVAISSLARAPSGRRLLGPKGSGGPKTPKASSTPKPD
DKLMGTMTGPPQGNN

MHLINAVAAARILSGIGQSNGNNGGEAIPFGSFEWITYAGISCFLVLFAGIMSGLTLGLM
SLGLVELEILQRSGTPNEKKQAAAIFPVVQKQHQLLVTLLLCNAMAMEGLPIYLDKLFNE
YVAIILSVTFVLAFGEVIPQAICTRYGLAVGANFVWLVRILMTLCYPIAFPIGKILDLVL
GHNDALFRRAQLKALVSIHSQEAGKGGELTHDETTIISGALDLTEKTAQEAMTPIESTFS
LDVNSKLDWEAMGKILARGHSRVPVYSGNPKNVIGLLLVKSLLTVRPETETLVSAVCIRR
IPRVPADMPLYDILNEFQKGSSHMAAVVKVKGKSKVPPSTLLEEHTDESNDSDLTAPLLL
KREGNHDNVIVTIDKANGQSFFQNNESGPHGFSHTSEAIEDGEVIGIITLEDVFEELLQE
EIVDETDEYVDVHKRIRVAAAAAASSIARAPSSRKLLAQKGTGGQNKQGQTNKVPGQEQD
KMLGTITEPIRRNN

www.000webhost.com

Other information
Ka divergence:-0.527397KaKs divergence:-0.442867
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1488Length 2 (bp):1485Length divergence:-0.001
MFE 1 (kcal):-469.04MFE 2 (kcal):-463.6MFE divergence-0.006