Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G14430-AT4G14440
Species:Arabidopsis
Duplication type:TD
Function (paralog1):indole-3-butyric acid response 10
Function (paralog2):3-hydroxyacyl-CoA dehydratase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.44468386887287
Log2 mRNA fold difference:0.80250584707112
Log2 TE fold difference:-0.37999470233316
Sequences
Protein sequence

MCTLEKRGDLFLLTLTGDGEHRFHPDTIATILSLLEQAKSQSTRGSILITTANGKFFSNG
FDLAWAQTAGSKTGAANRLHQMVESFKPVVAALLDLPMPTIAALNGHAAAAGLILALSHD
YVFMRKDRGVLYMSEVDIGLSMPDYFSALVRAKIGTSAARRELLLSGKKIRGEEAVGLGI
VDSAAYDSEEGVVVASVRLGEKLAAKKWSGEVYASIRKSLYPELCGILGLETRVFATPKL

MCTLEKRGDLFLLTLTGEDEHRFHPDTIASVLSLLEQAKSQSTKGSVLITTGHGKFFSNG
FDLAWAQSAGHGAIKRMHQMVKSFKPVLAALLDLPMPTIAALNGHAAASGLMFALSHDYV
FMRKDRGVLYMSEVDIGLPVPDYFSALVVAKVGSGIARRELLLSGKKLKGEEAVALGIVD
SAAHDSAEGVVEATVSLGESLAAKKWNGEVYATIRKSLYPELCRMVDLTANNLATHNL

Other information
Ka divergence:0.446642KaKs divergence:-0.178953
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):723Length 2 (bp):717Length divergence:-0.004
MFE 1 (kcal):-253.4MFE 2 (kcal):-251.8MFE divergence-0.003