Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G14710-AT4G14716
Species:Arabidopsis
Duplication type:TD
Function (paralog1):RmlC-like cupins superfamily protein
Function (paralog2):acireductone dioxygenase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.21314832424468
Log2 mRNA fold difference:-0.60191321528681
Log2 TE fold difference:0.3660352676492
Sequences
Protein sequence

MFSSFTCCDGREEVIQAWYMDDSEEDQRLPHHKDPKEFLSLDKLAELGVLSWRLDADNYE
TDEDLKKIRESRGYSYMDFCEVCPEKLPNYEVKVKSFFEEHLHTDEEIRYCVAGSGYFDV
RDRNEAWIRVWVKKGGMIVLPAGIYHRFTVDSDNYIKAMRLFVGEPVWTPYNRPHDHLPA
RKEYIDNFVKVNEGGVIDASA

MGEAVKDGREEVIQAWYMDDSEEDQRLPHHKDPKEFVSLDKLAELGVLSWRLDADNYETD
EDLKKIRESRGYSYMDFCEVCPEKLPNYEVKVKSFFEEHLHTDEEIRYCVAGTGYFDVRD
RNEAWIRVLVKKGGMIVLPAGIYHRFTVDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARK
EYVDNFMINASA

Other information
Ka divergence:-0.452005KaKs divergence:0.330579
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):606Length 2 (bp):579Length divergence:-0.023
MFE 1 (kcal):-185.3MFE 2 (kcal):-172.7MFE divergence-0.035