Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G16730-AT4G16740
Species:Arabidopsis
Duplication type:TD
Function (paralog1):terpene synthase 02
Function (paralog2):terpene synthase 03

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.29465169497093
Log2 mRNA fold difference:0.8182351580807
Log2 TE fold difference:-1.0094878465616
Sequences
Protein sequence

MGSSISPLAREYIYVKEVETAEKAILFKEEVRKTLNEIEGSIEQLEMIDSLQRLGISYHY
KHEIHDILRKIHDQHGEIERETQDLHATSLEFILLRQHGFDVSQDAFDVFISETGEFRKT
LHSDIKGLLSLYEASYFSMDSEFKLKETRIYANKRLSEFVAESSKTICREDETYILEMVK
RALETPYHWSIRRLEARWYINVYEKKHEMNPLLLEFAAIDFNMLQANHQEELKLISSWWN
STGLMKQLDFVRDRITESYFWTIGIFYEPEFKYCRKILTKIFMLIVIMDDIYDIYGTLEE
LELFTNVVEKWDVNHVERLPNYMRMCFLFLYNEINQIGYDVLRDKGLNVIPYLKQVWTDL
FKTFLTESKWYKTGHKPSFEEYMQNGVISSSVPTILLHLFSVLSDHISDQTLTDDSKNHS
VVRSCATILRLANDLATSTEEMARGDSPKSVQCYMYETRASEEEARRHMQSMISDSWDII
NSDLKTAHTSSLPRGFLAAAANLNRVVQCIYRHGDGHGSPEKTKTVDYIQSVLFNPVPL

MPKRQAQRRFTRKTDSKTPSQPLVSRRSANYQPSLWQHEYLLSLGNTYVKEDNVERVTLL
KQEVSKMLNETEGLLEQLELIDTLQRLGVSYHFEQEIKKTLTNVHVKNVRAHKNRIDRNR
WGDLYATALEFRLLRQHGFSIAQDVFDGNIGVDLDDKDIKGILSLYEASYLSTRIDTKLK
ESIYYTTKRLRKFVEVNKNETKSYTLRRMVIHALEMPYHRRVGRLEARWYIEVYGERHDM
NPILLELAKLDFNFVQAIHQDELKSLSSWWSKTGLTKHLDFVRDRITEGYFSSVGVMYEP
EFAYHRQMLTKVFMLITTIDDIYDIYGTLEELQLFTTIVEKWDVNRLEELPNYMKLCFLC
LVNEINQIGYFVLRDKGFNVIPYLKESWADMCTTFLKEAKWYKSGYKPNFEEYMQNGWIS
SSVPTILLHLFCLLSDQTLDILGSYNHSVVRSSATILRLANDLATSSEELARGDTMKSVQ
CHMHETGASEAESRAYIQGIIGVAWDDLNMEKKSCRLHQGFLEAAANLGRVAQCVYQYGD
GHGCPDKAKTVNHVRSLLVHPLPLN

www.000webhost.com

Other information
Ka divergence:-0.173945KaKs divergence:-0.099427
GC content 1 (%):40GC content 2 (%):43GC content divergence:0.036
Length 1 (bp):1620Length 2 (bp):1698Length divergence:0.024
MFE 1 (kcal):-424.93MFE 2 (kcal):-475.52MFE divergence0.056